View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS AY133179 985 bp DNA linear VRL 30-SEP-2002
DEFINITION HIV-1 isolate C15 clone A2b from USA pol protein (pol) gene,
partial cds
ACCESSION AY133179
VERSION AY133179.1 GI:23380329
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 985)
Show all sequences for reference 1
AUTHORS Ruff,C.T., Ray,S.C., Kwon,P., Zinn,R., Pendleton,A., Hutton,N.,
Ashworth,R., Gange,S., Quinn,T.C., Siliciano,R.F. and Persaud,D.
TITLE Persistence of wild-type virus and lack of temporal structure in
the latent reservoir for human immunodeficiency virus type 1 in
pediatric patients with extensive antiretroviral exposure
JOURNAL J. Virol. 76 (18), 9481-9492 (2002)
PUBMED 12186930
REFERENCE 2 (bases 1 to 985)
Show all sequences for reference 2
AUTHORS Ruff,C.T., Ray,S.C., Kwon,P., Zinn,R., Pendleton,A., Hutton,N.,
Ashworth,R., Gange,S., Quinn,T.C., Siliciano,R.F. and Persaud,D.
TITLE Direct Submission
JOURNAL Submitted (16-JUL-2002) Infectious Diseases, Department of
Medicine, Johns Hopkins University School of Medicine, 720 Rutland
Avenue, Ross 1049, Baltimore, MD 21205, USA
FEATURES Location/Qualifiers
source 1..985
/organism="Human immunodeficiency virus 1"
/proviral="Human immunodeficiency virus 1"
/mol_type="genomic DNA"
/isolate="C15"
/isolation_source="pediatric patient C15, 35 months of
HAART"
/db_xref="taxon:11676"
/clone="A2b"
/country="USA"
gene <1..>985
/gene="pol"
CDS <1..>985
/gene="pol"
/codon_start="1"
/transl_table="1"
/product="pol protein"
/protein_id="AAN18007.1"
/db_xref="GI:23380330"
/translation="PQITLWQRPLVEIKIGGQLKEALLDTGADDTVLEEINLPGRWKP
KMIGGIGGFIKVRQYDQIPIEICGHKAIGTVLVGPTPANIIGRNLLTQIGCTLNFPIS
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELETEGKISKTGPENPYNTPVF
AIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSVP
LDKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTQNPD
IVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLWKWGFYTPDKKHQKEPPFLW"
BASE COUNT 391 a 161 c 201 g 232 t
ORIGIN
1 cctcagatca ctctttggca acgacccctc gttgaaataa agataggggg gcaactaaag
61 gaagctctat tagatacagg agcagatgac acagtattag aagaaataaa tttgccagga
121 agatggaaac caaaaatgat agggggaatt ggaggtttta tcaaagtaag acagtatgat
181 cagataccca tagaaatctg tggacataaa gctataggta cagtgttagt aggacctaca
241 cctgccaaca taattggaag aaatctgttg actcagattg gttgcacttt aaattttccc
301 attagtccta ttgaaactgt accagtaaaa ttaaagccag gaatggatgg cccaaaagtt
361 aaacaatggc cattgacaga agaaaaaata aaagcattag tagaaatctg tacagaattg
421 gaaacagaag ggaaaatttc aaaaactggg cctgaaaatc catacaatac tccagtattt
481 gccataaaga aaaaagacag tactaaatgg agaaaattag tagacttcag agaacttaat
541 aagagaactc aagacttctg ggaagttcaa ttaggaatac cacatcctgg agggttaaaa
601 aagaaaaaat cagtaacagt actggatgtg ggtgatgcat atttttcagt tcctttagat
661 aaagaattca ggaagtatac tgcatttacc atacctagta taaacaatga gacaccaggg
721 attagatatc aatacaatgt gcttccacaa ggatggaaag gatcaccagc aatattccaa
781 agtagcatga caaaaatctt agagcctttt agaacacaaa atccagacat agtgatctat
841 caatacatgg atgatttgta tgtaggatct gacttagaaa tagggcagca tagaacaaaa
901 atagaggaac tgagacaaca tctgtggaag tggggatttt acacaccaga caaaaaacat
961 cagaaagaac ctccattcct ttgga
//
last modified: Tue May 31 10:56 2022