View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS AY133155 985 bp DNA linear VRL 30-SEP-2002
DEFINITION HIV-1 isolate C22 clone 5.3 from USA pol protein (pol) gene,
partial cds
ACCESSION AY133155
VERSION AY133155.1 GI:23380283
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 985)
Show all sequences for reference 1
AUTHORS Ruff,C.T., Ray,S.C., Kwon,P., Zinn,R., Pendleton,A., Hutton,N.,
Ashworth,R., Gange,S., Quinn,T.C., Siliciano,R.F. and Persaud,D.
TITLE Persistence of wild-type virus and lack of temporal structure in
the latent reservoir for human immunodeficiency virus type 1 in
pediatric patients with extensive antiretroviral exposure
JOURNAL J. Virol. 76 (18), 9481-9492 (2002)
PUBMED 12186930
REFERENCE 2 (bases 1 to 985)
Show all sequences for reference 2
AUTHORS Ruff,C.T., Ray,S.C., Kwon,P., Zinn,R., Pendleton,A., Hutton,N.,
Ashworth,R., Gange,S., Quinn,T.C., Siliciano,R.F. and Persaud,D.
TITLE Direct Submission
JOURNAL Submitted (16-JUL-2002) Infectious Diseases, Department of
Medicine, Johns Hopkins University School of Medicine, 720 Rutland
Avenue, Ross 1049, Baltimore, MD 21205, USA
FEATURES Location/Qualifiers
source 1..985
/organism="Human immunodeficiency virus 1"
/proviral="Human immunodeficiency virus 1"
/mol_type="genomic DNA"
/isolate="C22"
/isolation_source="pediatric patient C22, 18 months of
HAART"
/db_xref="taxon:11676"
/clone="5.3"
/country="USA"
gene <1..>985
/gene="pol"
CDS <1..>985
/gene="pol"
/codon_start="1"
/transl_table="1"
/product="pol protein"
/protein_id="AAN17985.1"
/db_xref="GI:23380284"
/translation="PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDMNLPGRWKP
KMIGGIGGFIKVRQYDQIPIEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNFPIS
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISRIGPENPYNTPVF
AIKKKDSTKWRKLIDFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSVP
LDKDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPD
IVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFYTPDKKHQKEPPFLW"
BASE COUNT 387 a 160 c 203 g 235 t
ORIGIN
1 cctcagatca ctctttggca acgacccctc gtcacaataa agataggggg gcaactaaag
61 gaagctctat tagatacagg agcagatgat acagtattag aagacatgaa tttgccagga
121 agatggaagc caaaaatgat agggggaatt ggaggtttta tcaaagtaag acagtatgat
181 cagataccca tagaaatctg tggacataag gctataggta cagtattaat aggacctaca
241 cctgtcaaca taattggaag aaatctgttg actcagattg gttgcacttt aaattttccc
301 attagtccta ttgaaactgt accagtaaaa ttaaagccag gaatggatgg cccaaaagtt
361 aaacaatggc cattgacaga agaaaaaata aaagcattag tagaaatttg tacagaaatg
421 gaaaaggaag ggaaaatttc aagaattggg cctgaaaatc catataatac tccagtattt
481 gccataaaga aaaaggacag tactaaatgg agaaaattaa tagactttag agaacttaat
541 aaaagaactc aagacttctg ggaggttcaa ttaggaatac cacatcccgg agggttaaag
601 aagaaaaaat cagtaacagt actggatgtg ggtgatgcat atttttcagt tcccttagat
661 aaagacttca ggaaatatac tgcatttacc atacctagta taaacaatga gacaccaggg
721 gttagatatc agtacaatgt gctgccacag ggatggaaag gatcaccagc aatattccaa
781 agtagcatga caaaaatctt agagcctttt agaaaacaaa atccagacat agttatctat
841 caatacatgg atgatttgta tgtaggatct gacttagaaa tagggcagca tagaacaaaa
901 atagaggaac taagacaaca tctcttgaag tggggatttt acacaccaga caaaaaacat
961 cagaaagaac ctccattcct ttgga
//
last modified: Tue May 31 10:56 2022