View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS AY133151 985 bp DNA linear VRL 30-SEP-2002
DEFINITION HIV-1 isolate C22 clone 2.4 from USA pol protein (pol) gene,
partial cds
ACCESSION AY133151
VERSION AY133151.1 GI:23380275
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 985)
Show all sequences for reference 1
AUTHORS Ruff,C.T., Ray,S.C., Kwon,P., Zinn,R., Pendleton,A., Hutton,N.,
Ashworth,R., Gange,S., Quinn,T.C., Siliciano,R.F. and Persaud,D.
TITLE Persistence of wild-type virus and lack of temporal structure in
the latent reservoir for human immunodeficiency virus type 1 in
pediatric patients with extensive antiretroviral exposure
JOURNAL J. Virol. 76 (18), 9481-9492 (2002)
PUBMED 12186930
REFERENCE 2 (bases 1 to 985)
Show all sequences for reference 2
AUTHORS Ruff,C.T., Ray,S.C., Kwon,P., Zinn,R., Pendleton,A., Hutton,N.,
Ashworth,R., Gange,S., Quinn,T.C., Siliciano,R.F. and Persaud,D.
TITLE Direct Submission
JOURNAL Submitted (16-JUL-2002) Infectious Diseases, Department of
Medicine, Johns Hopkins University School of Medicine, 720 Rutland
Avenue, Ross 1049, Baltimore, MD 21205, USA
FEATURES Location/Qualifiers
source 1..985
/organism="Human immunodeficiency virus 1"
/proviral="Human immunodeficiency virus 1"
/mol_type="genomic DNA"
/isolate="C22"
/isolation_source="pediatric patient C22, 18 months of
HAART"
/db_xref="taxon:11676"
/clone="2.4"
/country="USA"
gene <1..>985
/gene="pol"
CDS <1..>985
/gene="pol"
/codon_start="1"
/transl_table="1"
/product="pol protein"
/protein_id="AAN17981.1"
/db_xref="GI:23380276"
/translation="PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDMNLPGRWKP
KMIGGIGGFIKVRQYDQIPIEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNFPIS
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISRIGPENPYNTPVF
AIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVP
LDKDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPD
IVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFYTPDKKHQKEPPFLW"
BASE COUNT 387 a 163 c 202 g 233 t
ORIGIN
1 cctcagatca ctctttggca acgacccctc gtcacaataa agataggagg gcagctaaag
61 gaagctctat tagatacagg ggcagatgac acagtattag aagacatgaa tttgccagga
121 agatggaagc caaaaatgat agggggaatt ggaggtttta tcaaagtaag acagtatgat
181 cagataccca tagaaatctg tggacataaa gctataggta cagtattaat aggacctaca
241 cctgtcaaca taattggaag aaatctgttg actcagattg gttgcacttt aaattttccc
301 attagtccta ttgaaactgt accagtaaaa ttaaagccag gaatggatgg cccaaaagtt
361 aaacaatggc cattgacaga agaaaaaata aaagcattag tagaaatttg tacagaaatg
421 gaaaaggaag ggaaaatttc aagaattggg cctgaaaatc catataatac tccagtattt
481 gccataaaga aaaaggacag tactaaatgg agaaaattag tagactttag agaacttaat
541 aaaagaactc aagacttctg ggaggttcaa ttaggaatac cacatcccgc agggttaaag
601 aagaaaaaat cagtaacagt actggatgtg ggcgatgcat atttttcagt tcccttagat
661 aaagacttca ggaaatatac tgcatttacc atacctagta taaacaatga gacaccaggg
721 gttagatacc agtacaatgt gcttccacag ggatggaaag gatcaccagc aatattccaa
781 agtagcatga caaaaatctt agagcctttt agaaaacaaa atccagacat agttatctat
841 caatacatgg atgatttgta tgtaggatct gacttagaaa tagggcagca tagaacaaaa
901 atagaggaac taagacaaca tctattgaag tggggatttt acacaccaga caaaaaacat
961 cagaaagaac ctccattcct ttgga
//
last modified: Tue May 31 10:56 2022