View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS AY030739 1203 bp RNA linear VRL 16-AUG-2001
DEFINITION HIV-1 isolate NC1826-1998 from USA pol polyprotein (pol) gene,
partial cds
ACCESSION AY030739
VERSION AY030739.1 GI:13736515
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 1203)
Show all sequences for reference 1
AUTHORS Shafer,R., Gonzales,M.J. and Brun-Vezinet,F.
TITLE Online comparison of HIV-1 drug resistance algorithms identifies
rates and causes of discordant interpretations
JOURNAL Antiviral Therapy 6 (Suppl. 1), 101 (2001)
REFERENCE 2 (bases 1 to 1203)
Show all sequences for reference 2
AUTHORS Gonzales,M.J., Machekano,R.N. and Shafer,R.W.
TITLE Direct Submission
JOURNAL Submitted (10-APR-2001) Medicine, Division of Infectious Diseases &
Geographic Medicine, Stanford University Medical Center, 300
Pasteur Drive, S-156, Stanford, CA 94305, USA
REFERENCE 3
Show all sequences for reference 3
AUTHORS Gonzales,M.J., Machekano,R.N. and Shafer,R.W.
TITLE Human immunodeficiency virus type 1 reverse-transcriptase and
protease subtypes: classification, amino acid mutation patterns,
and prevalence in a northern California clinic-based population
JOURNAL J. Infect. Dis. 184 (8), 998-1006 (2001)
PUBMED 11574914
REFERENCE 4
Show all sequences for reference 4
AUTHORS Rhee,S.-Y., Fessel,W.J., Liu,T.F., Marlowe,N.M., Rowland,C.M.,
Rode,R.A., Vandamme,A.-M., Van Laethem,K., Brun-Vezinet,F.,
Calvez,V., Taylor,J., Hurley,L., Horberg,M. and Shafer,R.W.
TITLE Predictive value of HIV-1 genotypic resistance test interpretation
algorithms.
JOURNAL J. Infect. Dis.. 200(3); 453-63 (2009)
PUBMED 19552527
FEATURES Location/Qualifiers
source 1..1203
/organism="Human immunodeficiency virus 1"
/mol_type="genomic RNA"
/isolate="NC1826-1998"
/db_xref="taxon:11676"
/country="USA: Northern California"
gene <1..>1203
/gene="pol"
CDS <1..>1203
/gene="pol"
/codon_start="1"
/transl_table="1"
/product="pol polyprotein"
/protein_id="AAK35554.1"
/db_xref="GI:13736516"
/translation="PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMCLPGRWKP
KLIVGIGGFIKVRQYDQIAIEICGHKAIGXVLIGPTPVNIIGRNLXTQIGCTLNFPIS
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEQEGKISKIGPENPYNTPIF
AIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIP
LDKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPD
IVIYQYVDDLYVGSDLEIGQHRTKIKELREHLWKWGFYTPDRKHQKXPPFHWMGYELH
PDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTXALTEVV
PLTEEAELE"
BASE COUNT 465 a 198 c 256 g 278 t 6 other
ORIGIN
1 cctcagatca ctctttggca acgacccctc gtcacaataa agataggggg gcaactaaag
61 gaagctctat tagatacagg agcagatgat acagtattag aagaaatgtg tttgccagga
121 agatggaaac caaaattgat agtgggaatt ggaggtttta tcaaagtaag acagtatgat
181 cagatagcca tagaaatctg tggacataag gctataggtr cagtattaat aggacctaca
241 cctgtcaaca taattggaag aaatctgwtg actcagattg gttgcactct aaattttccc
301 attagtccta ttgaaactgt accagtgaaa ttaaagccag gaatggatgg cccaaaagtt
361 aaacaatggc cattgacaga agaaaaaata aaagcattag tagaaatttg tacagaactg
421 gaacaggaag gaaaaatttc aaaaattggg cctgaaaatc catacaatac tccaatattt
481 gccataaaga aaaaagacag tactaaatgg agaaaattag tagatttcag agagcttaat
541 aagagaactc aagacttctg ggaagttcaa ttaggaatac cacatcccgc agggttaaaa
601 aagaaaaaat cagtaacagt actggatgtg ggtgatgcat atttctcaat tcccttagat
661 aaagacttca ggaagtatac tgcatttacc atacctagta taaacaatga gacaccaggg
721 attagatatc agtacaatgt gcttccacaa ggatggaaag gatcaccagc aatattccaa
781 agtagcatga caaaaatctt agagcctttt agaaaacaga atccagacat agttatctat
841 caatacgtgg atgayttgta tgtaggatct gacttagaaa tagggcagca tagaacaaaa
901 ataaaggaac tgagagaaca tctgtggaag tggggatttt acacaccaga cagaaaacat
961 cagaaagamc ctccattyca ttggatgggt tatgaactcc atcctgataa atggacagta
1021 cagcctatag tgctgccaga aaaagacagc tggactgtca atgacataca gaagttagtg
1081 ggaaaattga attgggcaag tcagatttac ccagggatta aagtgaagca attgtgtaaa
1141 ctccttaggg gaaccamagc attaacagaa gtagtaccac taacagaaga agcagagcta
1201 gaa
//
last modified: Tue May 31 10:56 2022