View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS AM296492 738 bp RNA linear VRL 10-NOV-2006
DEFINITION Simian immunodeficiency virus partial env gene for envelope
glycoprotein and partial nef gene for negative factor protein,
genomic RNA, isolate SIVgorCP1436
ACCESSION AM296492
VERSION AM296492.1 GI:117910811
KEYWORDS env gene; envelope glycoprotein; nef gene; negative factor protein.
SOURCE Simian immunodeficiency virus
ORGANISM Simian immunodeficiency virus Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1
Show all sequences for reference 1
AUTHORS Van Heuverswyn,F., Li,Y., Neel,C., Bailes,E., Keele,B.F., Liu,W.,
Loul,S., Butel,C., Liegeois,F., Bienvenue,Y., Ngolle,E.M.,
Sharp,P.M., Shaw,G.M., Delaporte,E., Hahn,B.H. and Peeters,M.
TITLE Human immunodeficiency viruses: SIV infection in wild gorillas
JOURNAL Nature 444 (7116), 164 (2006)
PUBMED 17093443
REFERENCE 2 (bases 1 to 738)
Show all sequences for reference 2
AUTHORS Van Heuverswyn,F.
TITLE Direct Submission
JOURNAL Submitted (08-AUG-2006) Van Heuverswyn F., UMR145, IRD, 911 Avenue
Agropolis, 34394 Montpellier Cedex 5, FRANCE
COMMENT All of the Gorilla SIV sequences from this publication were Gorilla
gorilla gorilla (Western lowlands gorilla) subspecies. SIV-positive
samples from two different wildlife areas labeled CP and BQ, over
400 kilometers apart, were the same areas where chimpanzees were
sampled without finding any SIV-CPZ seropositive chimpanzees.
FEATURES Location/Qualifiers
source 1..738
/organism="Simian immunodeficiency virus"
/mol_type="genomic RNA"
/isolate="SIVgorCP1436"
/isolation_source="fecal matter"
/host="Gorilla gorilla (wild)"
/db_xref="taxon:11723"
/country="Cameroon"
gene <1..460
/gene="env"
CDS <1..460
/gene="env"
/note="gp41 region of env"
/codon_start="2"
/transl_table="1"
/product="envelope glycoprotein"
/protein_id="CAL30197.1"
/db_xref="GI:117910812"
/translation="YSPLSFQIPGRIQGPAGIVPGIEEEGGGADKSRSIRLLDGFLPL
VWDDLKTLVVWIYQTLATLISGIKELTILLIEQLSRFLRKTTDLLRDCFALVGYWGQE
LKQSAISLLDTVAVWTGNWTDQVIEVARRIGRGILNIPRRIRQGLERSLL"
gene 460..>738
/gene="nef"
CDS 460..>738
/gene="nef"
/codon_start="1"
/transl_table="1"
/product="negative factor protein"
/protein_id="CAL30198.1"
/db_xref="GI:117910813"
/translation="MGNAWKKSSLVGWPAVRDRMHQTNPEPEQPAPGVGIISRELAKG
KGIPAKYNPTNNASLAFLDAHDEEEVGFPVRPQVSVRPMTYKAAFDLSF"
BASE COUNT 245 a 146 c 188 g 159 t
ORIGIN
1 atactcacca ctgtcatttc agatccctgg ccggattcag ggcccagcag gaatagtacc
61 aggaatagaa gaagaaggtg gaggagcaga caaaagcaga tcgatcagat tgctggacgg
121 attcttgcct ctagtgtggg acgatctcaa gactctggtt gtgtggatct accagacatt
181 agccacctta atatcaggga tcaaggagct gacaatcctc ctgatcgagc agctgagcag
241 attcctgagg aaaacaactg acttgctaag agactgcttc gctttagttg gatactgggg
301 acaagagctt aaacaaagtg ctattagctt gctagacact gtggcagtct ggactgggaa
361 ttggactgat caagtaatag aagtagctag gagaatagga agaggaatat tgaacattcc
421 aagaagaatt aggcaggggc tagaaagaag cttattataa tggggaatgc ctggaaaaag
481 agtagcttag tagggtggcc agcagtgaga gacagaatgc atcaaactaa ccctgagcca
541 gaacaaccgg ctccaggagt aggtataatt tctagagaac tagcaaaagg aaaaggaata
601 cctgcaaaat ataacccaac aaacaatgcc tccttagcat tcctagatgc acacgatgag
661 gaggaagtag gatttccagt tagaccccaa gtatctgtaa gacccatgac ttataaagca
721 gcatttgacc tcagcttc
//
last modified: Tue May 31 10:56 2022