View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS AJ237791 622 bp DNA linear VRL 15-APR-2005
DEFINITION Human immunodeficiency virus type 1 partial p24 gene, isolate EQS16
ACCESSION AJ237791
VERSION AJ237791.1 GI:4995216
KEYWORDS p24 gene.
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1
Show all sequences for reference 1
AUTHORS Triques,K., Bourgeois,A., Saragosti,S., Vidal,N., Mpoudi-Ngole,E.,
Nzilambi,N., Apetrei,C., Ekwalanga,M., Delaporte,E. and Peeters,M.
TITLE High diversity of HIV-1 subtype F strains in Central Africa
JOURNAL Virology 259 (1), 99-109 (1999)
PUBMED 10364493
REFERENCE 2 (bases 1 to 622)
Show all sequences for reference 2
AUTHORS Triques,K.
TITLE Direct Submission
JOURNAL Submitted (25-MAR-1999) Triques K., Laboratoire Retrovirus, IRD,
34032, Montpellier, FRANCE
REFERENCE 3
Show all sequences for reference 3
AUTHORS Triques,K., Bourgeois,A., Vidal,N., Mpoudi-Ngole,E.,
Mulanga-Kabeya,C., Nzilambi,N., Torimiro,N., Saman,E., Delaporte,E.
and Peeters,M.
TITLE Near-full-length genome sequencing of divergent African HIV type 1
subtype F viruses leads to the identification of a new HIV type 1
subtype designated K
JOURNAL AIDS Res. Hum. Retroviruses 16 (2), 139-151 (2000)
PUBMED 10659053
COMMENT This sequence was shown by [1] to be a subtype F outlier, and
possibly a recombinant between the F1 and F2 groups discussed in
[1].
Reference Triques et al., ARHR (1999) in press, supports this
finding.
FEATURES Location/Qualifiers
source 1..622
/organism="Human immunodeficiency virus 1"
/proviral="Human immunodeficiency virus 1"
/mol_type="genomic DNA"
/strain="EQS16"
/isolate="EQS16"
/db_xref="taxon:11676"
/country="Democratic Republic of the Congo"
gene <1..>622
/gene="p24"
CDS <1..>622
/gene="p24"
/codon_start="1"
/transl_table="1"
/product="p24 protein"
/protein_id="CAB44300.1"
/db_xref="GI:4995217"
/db_xref="GOA:Q9WMW4"
/db_xref="InterPro:IPR000721"
/db_xref="InterPro:IPR008916"
/db_xref="InterPro:IPR008919"
/db_xref="UniProtKB/TrEMBL:Q9WMW4"
/translation="HQALSPRTLNAWVKVIEEKAFSPEVIPMFSALSEGATPQDLNTM
LNTVGGHQAAMQMLKDTINEEAAEWDRLHPVQAGPIPPGQLRDPRGSDIAGTTSTLQE
QIGWMTGNPPVPVGEIYKRWIILGLNKIVRMYSPVSILDIKQGPKEPFRDYVDRFFKT
LRAEQATQEVKGWMTDTLLVQNANPDCKTILKALGPGATLEEMMTAC"
BASE COUNT 222 a 127 c 146 g 127 t
ORIGIN
1 catcaggctc tatcacctag aactttaaat gcatgggtaa aagtgataga agaaaaggct
61 ttcagcccag aagtaatacc catgttttca gcattatcag aaggagccac tccacaagat
121 ttaaacacca tgctaaacac agtgggggga caccaagcag ctatgcaaat gttaaaagat
181 accatcaatg aggaagctgc agaatgggac aggttacacc cagtgcaggc aggacctatc
241 ccaccaggtc agctgagaga ccctagggga agtgatatag caggaactac tagtaccctt
301 caggaacaaa taggatggat gacaggcaac ccacctgtcc cagtgggaga aatctataaa
361 agatggataa tcctagggtt aaataagata gtcagaatgt atagccctgt cagcattttg
421 gacataaaac aagggccaaa agaacccttt agagactatg tagacaggtt ctttaaaact
481 ctaagagctg agcaagctac acaggaagta aagggttgga tgacagacac cttgttggtc
541 caaaatgcga atccagattg taagaccatt ttaaaagcac tgggaccagg ggctacacta
601 gaagaaatga tgacagcatg tc
//
last modified: Tue May 31 10:56 2022