View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS AF383892 985 bp RNA linear VRL 14-AUG-2001
DEFINITION HIV-1 isolate C12 clone 8.3 from USA pol protein (pol) gene,
partial cds
ACCESSION AF383892
VERSION AF383892.1 GI:15150171
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 985)
Show all sequences for reference 1
AUTHORS Hermankova,M., Ray,S.C., Ruff,C., Powell-Davis,M., Ingersoll,R.,
D'Aquila,R.T., Quinn,T.C., Siliciano,J.D., Siliciano,R.F. and
Persaud,D.
TITLE HIV-1 drug resistance profiles in children and adults with viral
load of <50 copies/ml receiving combination therapy
JOURNAL JAMA 286 (2), 196-207 (2001)
PUBMED 11448283
REFERENCE 2 (bases 1 to 985)
Show all sequences for reference 2
AUTHORS Hermankova,M., Ray,S.C., Ruff,C., Powell-Davis,M., Ingersoll,R.,
D'Aquila,R.T., Quinn,T.C., Siliciano,J.D., Siliciano,R.F. and
Persaud,D.
TITLE Direct Submission
JOURNAL Submitted (22-MAY-2001) Department of Medicine, Division of
Infectious Diseases, Johns Hopkins University School of Medicine,
720 Rutland Avenue, Ross 1049, Baltimore, MD 21205, USA
FEATURES Location/Qualifiers
source 1..985
/organism="Human immunodeficiency virus 1"
/mol_type="genomic RNA"
/isolate="C12"
/db_xref="taxon:11676"
/clone="8.3"
/country="USA"
/note="from plasma of pediatric patient C12; 33.7 months
of HAART"
gene <1..>985
/gene="pol"
CDS <1..>985
/gene="pol"
/codon_start="1"
/transl_table="1"
/product="pol protein"
/protein_id="AAK85333.1"
/db_xref="GI:15150172"
/translation="PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKP
KMIGGIGGFIKVRQYDQIPIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNFPIS
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVF
AIKKKEGTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVP
LDKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPD
IVIYQYMDDLYVGSDLEIEQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLW"
BASE COUNT 387 a 166 c 203 g 229 t
ORIGIN
1 cctcagatca ctctttggca acgacccctc gtcacaataa agataggggg gcaactaaag
61 gaagctctat tagatacagg agcagatgat acagtattag aagaaatgaa tttgccagga
121 agatggaaac caaaaatgat agggggaatt ggaggtttta tcaaagtaag acagtatgat
181 cagataccca tagaaatctg tggacacaaa gctataggta cagtcttagt aggacctaca
241 cctgtcaaca taattggaag aaatctgttg actcagattg gatgcacttt aaattttccc
301 attagtccta ttgaaactgt accagtaaaa ttaaagccag gaatggatgg cccaaaagtt
361 aaacaatggc cattgacaga agaaaaaata aaagcattag tagaaatctg tacagaaatg
421 gaaaaggaag ggaaaatttc aaaaattggg cctgaaaacc catacaatac tccagtattt
481 gctataaaga aaaaagaagg tactagatgg agaaaattag tagatttcag agaacttaat
541 aagagaactc aagacttctg ggaagttcaa ttaggaatac cacatcctgc agggttaaaa
601 aagaaaaaat cagtaacagt actggatgtg ggtgatgcat atttttcagt tcccttagat
661 aaagaattca ggaagtatac tgcatttacc atacctagta taaacaatga gacacccggg
721 attaggtatc agtacaatgt gcttccacag ggatggaaag gatcaccagc aatattccaa
781 agtagcatga caaaaatctt agagcctttt agaaaacaaa atccagacat agttatctat
841 caatacatgg atgatttgta tgtaggatct gacttagaga tagagcagca tagaacaaaa
901 atagaggaac tgagacaaca tctattgcgg tggggattta ccacaccaga caaaaaacac
961 cagaaagaac ccccattcct ctgga
//
last modified: Tue May 31 10:56 2022