View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS AF331700 297 bp DNA linear VRL 22-MAY-2002
DEFINITION HIV-1 isolate Pt11 from USA, protease (pol), partial cds
ACCESSION AF331700
VERSION AF331700.1 GI:13242144
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 297)
Show all sequences for reference 1
AUTHORS Gonzales,M.J., Machekano,R.N. and Shafer,R.W.
TITLE Human immunodeficiency virus type 1 reverse-transcriptase and
protease subtypes: classification, amino acid mutation patterns,
and prevalence in a northern California clinic-based population
JOURNAL J. Infect. Dis. 184 (8), 998-1006 (2001)
PUBMED 11574914
REFERENCE 2 (bases 1 to 297)
Show all sequences for reference 2
AUTHORS Gonzales,M.J., Machekano,R.N. and Shafer,R.W.
TITLE Direct Submission
JOURNAL Submitted (26-DEC-2000) Medicine, Division of Infectious Diseases
and Geographic Medicine, Stanford University Medical Center, 300
Pasteur Drive, S-156, Stanford, CA 94305, USA
FEATURES Location/Qualifiers
source 1..297
/organism="Human immunodeficiency virus 1"
/proviral="Human immunodeficiency virus 1"
/mol_type="genomic DNA"
/isolate="Pt11"
/db_xref="taxon:11676"
/country="USA"
/note="subtype: C"
gene <1..>297
/gene="pol"
CDS <1..>297
/gene="pol"
/codon_start="1"
/transl_table="1"
/product="protease"
/protein_id="AAK16573.1"
/db_xref="GI:13242145"
/translation="PQITLWQRPLVTIKVGGQLKEALLDTGADDTVLEEINLPGKWKP
KMIGGIGGFIKVRQYDQILIEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF"
BASE COUNT 110 a 47 c 66 g 73 t 1 other
ORIGIN
1 cctcaaatca ctctttggca gcgacccctt gtcacaataa aagtaggggg acagctaaag
61 gaggctctct tagacacagg agccgatgat acagtattag aagaaataaa tttaccagga
121 aaatggaaac caaaaatgat agggggaatt ggaggtttta ttaaagtaag gcartatgat
181 caaatactta tagaaatttg tggaaaaaag gctataggta cagtactagt agggcctaca
241 cctgtcaaca taattggaag aaatatgttg actcagcttg gatgcacact aaatttt
//
last modified: Tue May 31 10:56 2022