View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS AF273196 563 bp DNA linear VRL 19-NOV-2001
DEFINITION HIV-1 isolate 99KTG9 from South Korea pol protein (pol) gene,
partial cds
ACCESSION AF273196
VERSION AF273196.1 GI:8925679
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 563)
Show all sequences for reference 1
AUTHORS Sung,H., Foley,B.T., Bae,I.G., Chi,H.S. and Cho,Y.K.
TITLE Phylogenetic analysis of reverse transcriptase in antiretroviral
drug-naive Korean HIV type 1 patients
JOURNAL AIDS Res. Hum. Retroviruses 17 (16), 1549-1554 (2001)
PUBMED 11709099
REFERENCE 2 (bases 1 to 563)
Show all sequences for reference 2
AUTHORS Cho,Y.K., Lee,H.J. and Sung,H.
TITLE Direct Submission
JOURNAL Submitted (26-MAY-2000) Microbiology, University of Ulsan College
of Medicine, 388-1 Poongnap-dong, Songpa-ku, Seoul 138-040, South
Korea
REFERENCE 3
Show all sequences for reference 3
AUTHORS Cho,Y.K., Sung,H., Lee,H.J., Joo,C.H. and Cho,G.J.
TITLE Long-term intake of Korean red ginseng in HIV-1-infected patients:
development of resistance mutation to zidovudine is delayed
JOURNAL Int. Immunopharmacol. 1 (7), 1295-1305 (2001)
PUBMED 11460310
FEATURES Location/Qualifiers
source 1..563
/organism="Human immunodeficiency virus 1"
/proviral="Human immunodeficiency virus 1"
/mol_type="genomic DNA"
/isolate="99KTG9"
/db_xref="taxon:11676"
/country="South Korea"
gene <1..>563
/gene="pol"
CDS <1..>563
/gene="pol"
/codon_start="2"
/transl_table="1"
/product="pol protein"
/protein_id="AAF81579.1"
/db_xref="GI:8925680"
/translation="LVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDF
RELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDIGDAYFSVPLDEDFRKYTAFTIPSV
NNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVIYQYMDDLYVGSDL
EIGQHRIKIEELRQHLLKWGFSTPDKK"
BASE COUNT 230 a 86 c 111 g 136 t
ORIGIN
1 attagtagaa atttgtacag aaatggaaaa ggaaggaaaa atttcaaaaa ttgggcctga
61 aaatccatat aatactccag tatttgccat aaagaaaaaa gacagtacta aatggagaaa
121 attagtagat ttcagagaac ttaataagag aactcaagac ttctgggaag ttcaattagg
181 aataccacat ccagcagggt taaaaaagaa aaaatcagta acagtactag atataggtga
241 tgcatatttt tcagttccct tagatgaaga cttcaggaag tatactgcat ttaccatacc
301 tagtgtaaac aatgagacac cagggattag atatcagtac aatgtgcttc cacaggggtg
361 gaaaggatca ccagcgatat tccaaagtag catgacaaga atcttagagc cttttagaaa
421 gcaaaatcca gacatagtca tctatcaata catggatgat ttatatgtag gatctgactt
481 agaaatagga cagcatagaa taaaaataga ggaactgaga caacatctgt tgaagtgggg
541 attttccaca ccagacaaaa aac
//
last modified: Tue May 31 10:56 2022