View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS AF273194 564 bp DNA linear VRL 19-NOV-2001
DEFINITION HIV-1 isolate 94PJH9 from South Korea pol protein (pol) gene,
partial cds
ACCESSION AF273194
VERSION AF273194.1 GI:8925675
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 564)
Show all sequences for reference 1
AUTHORS Sung,H., Foley,B.T., Bae,I.G., Chi,H.S. and Cho,Y.K.
TITLE Phylogenetic analysis of reverse transcriptase in antiretroviral
drug-naive Korean HIV type 1 patients
JOURNAL AIDS Res. Hum. Retroviruses 17 (16), 1549-1554 (2001)
PUBMED 11709099
REFERENCE 2 (bases 1 to 564)
Show all sequences for reference 2
AUTHORS Cho,Y.K., Lee,H.J. and Sung,H.
TITLE Direct Submission
JOURNAL Submitted (26-MAY-2000) Microbiology, University of Ulsan College
of Medicine, 388-1 Poongnap-dong, Songpa-ku, Seoul 138-040, South
Korea
REFERENCE 3
Show all sequences for reference 3
AUTHORS Cho,Y.K., Sung,H., Lee,H.J., Joo,C.H. and Cho,G.J.
TITLE Long-term intake of Korean red ginseng in HIV-1-infected patients:
development of resistance mutation to zidovudine is delayed
JOURNAL Int. Immunopharmacol. 1 (7), 1295-1305 (2001)
PUBMED 11460310
FEATURES Location/Qualifiers
source 1..564
/organism="Human immunodeficiency virus 1"
/proviral="Human immunodeficiency virus 1"
/mol_type="genomic DNA"
/isolate="94PJH9"
/db_xref="taxon:11676"
/country="South Korea"
gene <1..>564
/gene="pol"
CDS <1..>564
/gene="pol"
/codon_start="3"
/transl_table="1"
/product="pol protein"
/protein_id="AAF81577.1"
/db_xref="GI:8925676"
/translation="LVEICTEMEKEGKISKIGPENPYNTPVFAIKKKASTKWRKLVDF
RELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSV
NNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVIYQYMDDLYVGSDL
EIGQHRIKVEELRQHLLKWGFTTPDKK"
BASE COUNT 225 a 89 c 113 g 137 t
ORIGIN
1 cattagtaga aatttgtaca gaaatggaaa aggaaggaaa aatttcaaaa attgggcctg
61 aaaatccata taatactcca gtatttgcca taaagaaaaa agccagtact aaatggagaa
121 aattagtaga tttcagagaa cttaataaga gaactcaaga cttctgggaa gttcaattag
181 gaatccccca tccagcaggg ttaaaaaaga aaaaatcagt aacagtactg gatgtgggtg
241 atgcatattt ttcagttccc ttagatgaag acttcagaaa gtatactgca tttaccatac
301 ctagtgtaaa caatgagaca ccagggatta gatatcagta caatgtgctt ccacaggggt
361 ggaaaggatc accagcgata ttccaatgta gcatgacaaa aatcttagag ccttttagaa
421 aacaaaatcc agacatagtt atctatcaat acatggatga tttatatgta ggatctgact
481 tagaaatagg gcagcataga ataaaagtag aggaactgag acaacatctg ttgaagtggg
541 gatttaccac accagacaaa aaac
//
last modified: Tue May 31 10:56 2022