View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS AF252111 354 bp DNA linear VRL 18-SEP-2000
DEFINITION HIV-1 strain CAM19 from Cameroon envelope glycoprotein (env) gene,
partial cds
ACCESSION AF252111
VERSION AF252111.1 GI:10180860
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 354)
Show all sequences for reference 1
AUTHORS Peter,F.N., Fonjungo,P.N., Eitel,M.N., Mpoudi,E.N., Judith,T.N.,
Torimiro,J.N., George,A.A., Alemnji,G.A., Laura,E.T., Eno,L.T.,
Nkengasong,J.N., John,N.N., Gao,F., Feng,G., Mark,R., Rayfield,M.,
Thomas,F.M., Folks,T.M., Danuta,P., Pieniazek,D., Renu,L.B. and
Lal,R.B.
TITLE Presence of Diverse Human Immunodeficiency Virus Type 1 Viral
Variants in Cameroon
JOURNAL AIDS Res. Hum. Retroviruses 16 (13), 1319-1324 (2000)
PUBMED 10957729
REFERENCE 2 (bases 1 to 354)
Show all sequences for reference 2
AUTHORS Fonjungo,P.N., Mpoudi,E.N., Torimiro,J.N., Alemnji,G.A., Eno,L.T.,
Ngengasong,J.N., Gao,F., Rayfield,M., Folks,T.M., Pieniazek,D. and
Lal,R.B.
TITLE Direct Submission
JOURNAL Submitted (04-APR-2000) HIV/Retrovirus Disease Branch, DASTLR,
Centers for Disease Control and Prevention, 1600 Clifton Road, Mail
Stop G-19, Atlanta, GA 30333, USA
COMMENT This sequence is more closely related to the CRF11_cpx circulating
recombinant form, than to other subtypes and CRFs, but the sequence
is short, and not closely enough related to a CRF11 sequence to
make confident confirmation of this. A BLAST search (12/5/2002)
shows it as 91% identical to 3 CRF11 isolates, but also 88% to 89%
identical to sequences from Cameroon which are listed as subtypes A
and G. May be the same cohort of patients reported in Fonjungo 2002
[PMID 11880402].
FEATURES Location/Qualifiers
source 1..354
/organism="Human immunodeficiency virus 1"
/proviral="Human immunodeficiency virus 1"
/mol_type="genomic DNA"
/strain="CAM19"
/db_xref="taxon:11676"
/country="Cameroon"
/note="subtype: unknown"
gene <1..>354
/gene="env"
CDS <1..>354
/gene="env"
/note="gp41 domain"
/codon_start="1"
/transl_table="1"
/product="envelope glycoprotein"
/protein_id="AAG14320.1"
/db_xref="GI:10180861"
/translation="AQQHLLKLTVWGIKQLQARVLAVERYLKDQQLLGIWGCSGKLIC
TTNVPWNVSWSSEIWDNMTWIEWEREVGNYTQIIYNLLEESQNQQEKNEQELLALDKW
ANLWNWFDISNWLWYI"
BASE COUNT 122 a 62 c 87 g 83 t
ORIGIN
1 gcacaacagc atctgttaaa actcactgtc tggggcataa aacagctcca ggcaagagtc
61 ctggctgtag aaagatacct aaaggatcaa cagctcctag ggatttgggg ctgctctgga
121 aaactcatct gcaccactaa tgtgccctgg aatgttagtt ggagtagtga gatttgggat
181 aacatgacct ggatagaatg ggaaagagag gttggcaatt acacacaaat aatatacaac
241 ctacttgagg aatcgcagaa ccagcaggaa aagaatgaac aagaattatt ggcattagac
301 aaatgggcaa atctgtggaa ttggtttgac atatcaaatt ggctatggta tata
//
last modified: Tue May 31 10:56 2022