HIV Databases HIV Databases home HIV Databases home
HIV Sequence Database



Download: ENTIRE SEQUENCE SEQUENCE FRAGMENT start end
Format:  
View NCBI entry		Download GenBank file		Graphics View		Download GFF3 File

LOCUS	    AF252111		     354 bp    DNA     linear	VRL 18-SEP-2000
DEFINITION  HIV-1 strain CAM19 from Cameroon envelope glycoprotein (env) gene,
	    partial cds
ACCESSION   AF252111
VERSION     AF252111.1 GI:10180860
KEYWORDS    .
SOURCE	    Human immunodeficiency virus 1 (HIV-1)
  ORGANISM  Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
	    Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
	    group
REFERENCE   1 (bases 1 to 354)
            Show all sequences for reference 1
  AUTHORS   Peter,F.N., Fonjungo,P.N., Eitel,M.N., Mpoudi,E.N., Judith,T.N.,
	    Torimiro,J.N., George,A.A., Alemnji,G.A., Laura,E.T., Eno,L.T.,
	    Nkengasong,J.N., John,N.N., Gao,F., Feng,G., Mark,R., Rayfield,M.,
	    Thomas,F.M., Folks,T.M., Danuta,P., Pieniazek,D., Renu,L.B. and
	    Lal,R.B.
  TITLE     Presence of Diverse Human Immunodeficiency Virus Type 1 Viral
	    Variants in Cameroon
  JOURNAL   AIDS Res. Hum. Retroviruses 16 (13), 1319-1324 (2000)
  PUBMED    10957729
REFERENCE   2 (bases 1 to 354)
            Show all sequences for reference 2
  AUTHORS   Fonjungo,P.N., Mpoudi,E.N., Torimiro,J.N., Alemnji,G.A., Eno,L.T.,
	    Ngengasong,J.N., Gao,F., Rayfield,M., Folks,T.M., Pieniazek,D. and
	    Lal,R.B.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-APR-2000) HIV/Retrovirus Disease Branch, DASTLR,
	    Centers for Disease Control and Prevention, 1600 Clifton Road, Mail
	    Stop G-19, Atlanta, GA 30333, USA
COMMENT     This sequence is more closely related to the CRF11_cpx circulating
	    recombinant form, than to other subtypes and CRFs, but the sequence
	    is short, and not closely enough related to a CRF11 sequence to
	    make confident confirmation of this. A BLAST search (12/5/2002)
	    shows it as 91% identical to 3 CRF11 isolates, but also 88% to 89%
	    identical to sequences from Cameroon which are listed as subtypes A
	    and G. May be the same cohort of patients reported in Fonjungo 2002
	    [PMID 11880402].
FEATURES             Location/Qualifiers
     source	     1..354
		     /organism="Human immunodeficiency virus 1"
		     /proviral="Human immunodeficiency virus 1"
		     /mol_type="genomic DNA"
		     /strain="CAM19"
		     /db_xref="taxon:11676"
		     /country="Cameroon"
		     /note="subtype: unknown"
     gene	     <1..>354
		     /gene="env"
     CDS	     <1..>354
		     /gene="env"
		     /note="gp41 domain"
		     /codon_start="1"
		     /transl_table="1"
		     /product="envelope glycoprotein"
		     /protein_id="AAG14320.1"
		     /db_xref="GI:10180861"
		     /translation="AQQHLLKLTVWGIKQLQARVLAVERYLKDQQLLGIWGCSGKLIC
		     TTNVPWNVSWSSEIWDNMTWIEWEREVGNYTQIIYNLLEESQNQQEKNEQELLALDKW
		     ANLWNWFDISNWLWYI"
BASE COUNT	122 a	  62 c	   87 g     83 t
ORIGIN
       1 gcacaacagc atctgttaaa actcactgtc tggggcataa aacagctcca ggcaagagtc 
      61 ctggctgtag aaagatacct aaaggatcaa cagctcctag ggatttgggg ctgctctgga 
     121 aaactcatct gcaccactaa tgtgccctgg aatgttagtt ggagtagtga gatttgggat 
     181 aacatgacct ggatagaatg ggaaagagag gttggcaatt acacacaaat aatatacaac 
     241 ctacttgagg aatcgcagaa ccagcaggaa aagaatgaac aagaattatt ggcattagac 
     301 aaatgggcaa atctgtggaa ttggtttgac atatcaaatt ggctatggta tata
//
last modified: Tue May 31 10:56 2022


Questions or comments? Contact us at seq-info@lanl.gov.

 
Operated by Triad National Security, LLC for the U.S. Department of Energy's National Nuclear Security Administration
© Copyright Triad National Security, LLC. All Rights Reserved | Disclaimer/Privacy

Dept of Health & Human Services Los Alamos National Institutes of Health