View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS AF197869 105 bp RNA linear VRL 15-NOV-2000
DEFINITION HIV-1 isolate #247 from USA envelope protein V3 domain (env) gene,
partial cds
ACCESSION AF197869
VERSION AF197869.1 GI:7595322
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 105)
Show all sequences for reference 1
AUTHORS Locher,C.P., Grant,R.M., Collisson,E.A., Reyes-Teran,G., Elbeik,T.,
Kahn,J.O. and Levy,J.A.
TITLE Antibody and cellular immune responses in breakthrough infection
subjects after HIV type 1 glycoprotein 120 vaccination
JOURNAL AIDS Res. Hum. Retroviruses 15 (18), 1685-1689 (1999)
PUBMED 10606091
REFERENCE 2 (bases 1 to 105)
Show all sequences for reference 2
AUTHORS Grant,R.M.
TITLE Direct Submission
JOURNAL Submitted (23-OCT-1999) Virology and Immunology, Gladstone/UCSF, PO
Box 419100, San Francisco, CA 94141, USA
FEATURES Location/Qualifiers
source 1..105
/organism="Human immunodeficiency virus 1"
/mol_type="genomic RNA"
/isolate="vaccine recipient #247"
/db_xref="taxon:11676"
/tissue_type="plasma"
/country="USA: San Francisco, California"
/note="months 1 and 5 after infection"
gene <1..>105
/gene="env"
CDS <1..>105
/gene="env"
/codon_start="1"
/transl_table="1"
/product="envelope protein V3 domain"
/protein_id="AAF64409.1"
/db_xref="GI:7595323"
/translation="CTRPYNNTRRSVHIGPGRAFYATGDIIGDIRQASC"
BASE COUNT 42 a 17 c 25 g 21 t
ORIGIN
1 tgtacaagac cctacaacaa tacgaggaga agtgtacata taggaccagg gagagcattt
61 tatgcaacag gagacataat aggagatata agacaagcat cttgt
//
last modified: Tue May 31 10:56 2022