View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS AF137718 591 bp RNA linear VRL 08-FEB-2000
DEFINITION HIV-1 p1p080-333 from USA envelope glycoprotein (env) gene, partial
cds
ACCESSION AF137718
VERSION AF137718.1 GI:6933982
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 591)
Show all sequences for reference 1
AUTHORS Shankarappa,R., Margolick,J.B., Gange,S., Gange,S.J., Rodrigo,A.G.,
Upchurch,D., Farzadegan,H., Gupta,P., Rinaldo,C.R., Learn,G.H.,
He,X., Huang,X.-L. and Mullins,J.I.
TITLE Consistent viral evolutionary changes associated with the
progression of human immunodeficiency virus type 1 infection
JOURNAL J. Virol. 73 (12), 10489-10502 (1999)
PUBMED 10559367
REFERENCE 2 (bases 1 to 591)
Show all sequences for reference 2
AUTHORS Shankarappa,R., Margolick,J.B., Farzadegan,H., Gange,S.J.,
Gupta,P., Rinaldo,C.R., Upchurch,D., Rodrigo,A.G., Learn,G.H.,
Huang,X.-L., Fan,Z. and Mullins,J.I.
TITLE Direct Submission
JOURNAL Submitted (26-MAR-1999) Department of Microbiology, University of
Washington, Box 357740, Seattle, WA 98195-7740, USA
REFERENCE 3
Show all sequences for reference 3
AUTHORS Jensen,M.A., Li,F., van 't Wout,A.B., Nickle,D.C., Shriner,D.,
He,H.-X., McLaughlin,S., Shankarappa,R., Margolick,J.B. and
Mullins,J.I.
CONSRTM Multicenter AIDS Cohort Study
TITLE Improved Coreceptor Usage Prediction and Genotypic Monitoring of
R5-to-X4 Transition by Motif Analysis of Human Immunodeficiency
Virus Type 1 env V3 Loop Sequences
JOURNAL J. Virol. 77 (24), 13376-13388 (2003)
PUBMED 14645592
COMMENT Sequences AF204402-204670, AF137629-138703, and AY348544-348333:
the 3-digit number in each sample name is months
post-seroconversion. Sampling years are estimated based on
enrollment in 1983-84 incremented by months post-seroconversion.
Data on viral load, CD4, and CD8 provided by J. Mullins [JM 3/06]
FEATURES Location/Qualifiers
source 1..591
/organism="Human immunodeficiency virus 1"
/mol_type="genomic RNA"
/db_xref="taxon:11676"
/clone="p1p080-333"
/country="USA"
gene <1..>591
/gene="env"
CDS <1..>591
/gene="env"
/note="gp120; C2-V5 region"
/codon_start="1"
/transl_table="1"
/product="envelope glycoprotein"
/protein_id="AAF31585.1"
/db_xref="GI:6934119"
/translation="EKEVVIRSENFTDNAKTIIVQLNESVVINCTRPSNNTRRSIAVG
PGRAFYATDQIIGDIRKAHCNLSRAAWNNTLGQIVEKLREQFGNKTIVFNRSSGGDPE
IVMHSFNCGGEFFYCNTTQLFNSTWNTSTLNNEGSETITLQCRIKQIINMWQEVGKAM
YAPPINGQIRCPSNITGLLLTRDGGSNTNNTEIFRPG"
BASE COUNT 236 a 92 c 123 g 140 t
ORIGIN
1 gaaaaagagg tagtaatcag atctgaaaat ttcacggaca atgctaaaac cataatagta
61 cagctgaatg agtctgtagt aattaattgt acaagaccca gtaacaatac aagaagaagt
121 atagcggtag gaccagggag agcattttat gcaacagatc aaataatagg agatataaga
181 aaagcacatt gtaaccttag tagggcagca tggaataaca ctttaggaca gatagttgag
241 aaattaagag aacaatttgg gaataaaaca atagtcttta atcgatcctc aggaggggac
301 ccagaaattg taatgcacag ttttaattgt ggaggggaat ttttctactg taatacaaca
361 caactgttta atagtacttg gaatactagt actttaaata atgaagggtc agagacgatc
421 acactccaat gcagaataaa acaaattata aacatgtggc aggaagtagg aaaagcaatg
481 tatgcccctc ccatcaacgg acaaattaga tgtccatcaa atattacagg gctgctatta
541 acaagagatg gtggcagtaa cacaaacaat actgaaatct tcagacctgg a
//
last modified: Tue May 31 10:56 2022