View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS AF137681 606 bp DNA linear VRL 08-FEB-2000
DEFINITION HIV-1 p1c061-04 from USA envelope glycoprotein (env) gene, partial
cds
ACCESSION AF137681
VERSION AF137681.1 GI:6933945
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 606)
Show all sequences for reference 1
AUTHORS Shankarappa,R., Margolick,J.B., Gange,S., Gange,S.J., Rodrigo,A.G.,
Upchurch,D., Farzadegan,H., Gupta,P., Rinaldo,C.R., Learn,G.H.,
He,X., Huang,X.-L. and Mullins,J.I.
TITLE Consistent viral evolutionary changes associated with the
progression of human immunodeficiency virus type 1 infection
JOURNAL J. Virol. 73 (12), 10489-10502 (1999)
PUBMED 10559367
REFERENCE 2 (bases 1 to 606)
Show all sequences for reference 2
AUTHORS Shankarappa,R., Margolick,J.B., Farzadegan,H., Gange,S.J.,
Gupta,P., Rinaldo,C.R., Upchurch,D., Rodrigo,A.G., Learn,G.H.,
Huang,X.-L., Fan,Z. and Mullins,J.I.
TITLE Direct Submission
JOURNAL Submitted (26-MAR-1999) Department of Microbiology, University of
Washington, Box 357740, Seattle, WA 98195-7740, USA
REFERENCE 3
Show all sequences for reference 3
AUTHORS Jensen,M.A., Li,F., van 't Wout,A.B., Nickle,D.C., Shriner,D.,
He,H.-X., McLaughlin,S., Shankarappa,R., Margolick,J.B. and
Mullins,J.I.
CONSRTM Multicenter AIDS Cohort Study
TITLE Improved Coreceptor Usage Prediction and Genotypic Monitoring of
R5-to-X4 Transition by Motif Analysis of Human Immunodeficiency
Virus Type 1 env V3 Loop Sequences
JOURNAL J. Virol. 77 (24), 13376-13388 (2003)
PUBMED 14645592
COMMENT Sequences AF204402-204670, AF137629-138703, and AY348544-348333:
the 3-digit number in each sample name is months
post-seroconversion. Sampling years are estimated based on
enrollment in 1983-84 incremented by months post-seroconversion.
Data on viral load, CD4, and CD8 provided by J. Mullins [JM 3/06]
FEATURES Location/Qualifiers
source 1..606
/organism="Human immunodeficiency virus 1"
/proviral="Human immunodeficiency virus 1"
/mol_type="genomic DNA"
/db_xref="taxon:11676"
/clone="p1c061-04"
/country="USA"
gene <1..>606
/gene="env"
CDS <1..>606
/gene="env"
/note="gp120; C2-V5 region"
/codon_start="1"
/transl_table="1"
/product="envelope glycoprotein"
/protein_id="AAF31548.1"
/db_xref="GI:6934082"
/translation="EKEVVIRSENFTDNAKTIIVQLNESVVINCTRPNNNTRRSIHVG
PGRAIYATGRIIGDIRQAHCNLSRAAWNNTLNQVVKKLREQFGNKTIVFNRSSGGDPE
IVMHSFNCGGEFFYCNTTQLFNSTWNTSTLNNVTEGSEKITLPCRIKQIINMWQEVGK
AMYAPPISGQIRCSSNITGLLLTRDGGRGNNTSSTTETFRPG"
BASE COUNT 239 a 96 c 128 g 143 t
ORIGIN
1 gaaaaagagg tagtaattag atctgaaaat ttcacggaca atgctaaaac cataatagta
61 cagctgaatg agtctgtagt aattaattgt acaagaccca ataacaatac aagaagaagt
121 atacatgtag gaccagggag agcaatttat gcaacaggaa gaataatagg agatataaga
181 caagcacatt gtaaccttag tagagcagca tggaataaca ctttaaacca ggtagttaag
241 aaattaagag aacaatttgg gaataaaaca atagtcttta atcgatcctc aggaggggac
301 ccagaaattg tgatgcacag ttttaattgt ggaggggaat ttttctactg taatacaaca
361 caactgttta atagtacttg gaatactagt actttaaata atgttactga agggtcagag
421 aagatcacac tcccatgcag aataaaacaa attataaaca tgtggcagga agtaggaaaa
481 gcaatgtatg cccctcccat cagtggacaa attagatgtt catcaaatat tacagggctg
541 ctattaacaa gagatggtgg caggggcaat aacacgagca gcactaccga aaccttcaga
601 cctgga
//
last modified: Tue May 31 10:56 2022