View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS AF127571 529 bp DNA linear VRL 31-MAR-2000
DEFINITION HIV-1 subtype F from Brazil nef protein (nef) gene, partial cds;
and 3' long terminal repeat, partial sequence
ACCESSION AF127571
VERSION AF127571.1 GI:7188376
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 529)
Show all sequences for reference 1
AUTHORS Jeeninga,R.E., Hoogenkamp,M., Armand-Ugon,M., de Baar,M.,
Verhoef,K. and Berkhout,B.
TITLE Functional differences between the long terminal repeat
transcriptional promoters of human immunodeficiency virus type 1
subtypes A through G
JOURNAL J. Virol. 74 (8), 3740-3751 (2000)
PUBMED 10729149
REFERENCE 2 (bases 1 to 529)
Show all sequences for reference 2
AUTHORS Jeeninga,R.E.
TITLE Direct Submission
JOURNAL Submitted (11-FEB-1999) AMC, Meibergdreef 15, Amsterdam 1105 AZ,
Netherlands
FEATURES Location/Qualifiers
source 1..529
/organism="Human immunodeficiency virus 1"
/proviral="Human immunodeficiency virus 1"
/mol_type="genomic DNA"
/db_xref="taxon:11676"
/country="Brazil"
/note="subtype: F"
LTR 1..>529
/note="3'' long terminal repeat"
gene <1..338
/gene="nef"
CDS <1..329
/gene="nef"
/codon_start="3"
/transl_table="1"
/product="nef protein"
/protein_id="AAF37745.1"
/db_xref="GI:7188377"
/translation="EGLIYSKKRQEILDLWVYHTQGYFPDWQNYTPGPGIRYPLTLGW
CFKLVPVDPEEVEKANEGENNCLLHPMSQHGMEDDDKEVLKWEFDSRLALRHIARERH
PEYYQD"
TATA_signal 447..450
BASE COUNT 151 a 120 c 151 g 107 t
ORIGIN
1 tggaagggtt aatttactcc aagaaaagac aagagatcct tgatctgtgg gtctaccaca
61 cacaaggcta cttccctgat tggcagaact acacaccagg gccagggatc agatatccac
121 tgaccttggg gtggtgcttc aagttagtac cagttgatcc agaggaggta gaaaaggcca
181 atgaaggaga gaacaactgc ttgctacacc ccatgagcca acatggaatg gaggatgatg
241 acaaagaagt actaaagtgg gagtttgaca gccgcctggc actgagacac atagccagag
301 agagacatcc ggagtactac caagactgag actgctgaca cagagattgc tgacacagaa
361 gaatctaaag ggactttccg ctggggactt tccagagggc ggtccagagg gcgggactgg
421 ggagtggctc accctcagat gctgcatata agcagccgct tttcgcctgt actgggtctc
481 tctagttaga ccagatttga gcctgggagc tctctggcta gctagggaa
//
last modified: Tue May 31 10:56 2022