HIV Databases HIV Databases home HIV Databases home
HIV Sequence Database



Download: ENTIRE SEQUENCE SEQUENCE FRAGMENT start end
Format:  
View NCBI entry		Download GenBank file		Graphics View		Download GFF3 File

LOCUS	    AF023397		     243 bp    DNA     linear	VRL 02-AUG-2001
DEFINITION  HIV-1 patient 224, sample 1994, clone 3 from Italy, envelope
	    glycoprotein V3 region (env) gene, partial cds
ACCESSION   AF023397
VERSION     AF023397.1 GI:2570739
KEYWORDS    .
SOURCE	    Human immunodeficiency virus 1 (HIV-1)
  ORGANISM  Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
	    Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
	    group
REFERENCE   1 (bases 1 to 243)
            Show all sequences for reference 1
  AUTHORS   Scarlatti,G., Leitner,T., Halapi,E., Wahlberg,J., Marchisio,P.,
	    Clerici-Schoeller,M.A., Wigzell,H., Fenyo,E.M., Albert,J., Uhlen,M.
	    and Rossi,P.
  TITLE     Comparison of variable region 3 sequences of human immunodeficiency
	    virus type 1 from infected children with the RNA and DNA sequences
	    of the virus populations of their mothers
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 90 (5), 1721-1725 (1993)
  PUBMED    8446584
REFERENCE   2 (bases 1 to 243)
            Show all sequences for reference 2
  AUTHORS   Halapi,E., Leitner,T., Jansson,M., Scarlatti,G., Orlandi,P.,
	    Plebani,A., Romiti,L., Albert,J., Wigzell,H. and Rossi,P.
  TITLE     Correlation between HIV sequence evolution, specific immune
	    response and clinical outcome in vertically infected infants
  JOURNAL   AIDS 11 (14), 1709-1717 (1997)
  PUBMED    9386805
REFERENCE   3 (bases 1 to 243)
            Show all sequences for reference 3
  AUTHORS   Halapi,E.
  TITLE     Direct Submission
  JOURNAL   Submitted (09-SEP-1997) MTC, Karolinska Institute, Doktorsringen
	    13, Box 280, Stockholm 171 77, Sweden
COMMENT     All mothers in this study were drug users or sexual partners of
	    drug users.
FEATURES             Location/Qualifiers
     source	     1..243
		     /organism="Human immunodeficiency virus 1"
		     /mol_type="genomic DNA"
		     /isolate="patient 224"
		     /db_xref="taxon:11676"
		     /clone="3"
		     /note="sample 1994 HIV-infected children attending clinics
		     in Milano, Italy"
     gene	     <1..>243
		     /gene="env"
     CDS	     <1..>243
		     /gene="env"
		     /note="V3 region"
		     /codon_start="1"
		     /transl_table="1"
		     /product="envelope glycoprotein"
		     /protein_id="AAB82246.1"
		     /db_xref="GI:2570740"
		     /translation="NGSLAEEEVVIKSDNFTDNTKVIIVQLNETVQINCTRPNNNTRK
		     SIHMGPGRAFYTTGIIGDIRQAHCNLSRAAWNNTLKQ"
BASE COUNT	107 a	  41 c	   46 g     49 t
ORIGIN
       1 aatggcagtc tagcagaaga agaggtagta attaaatcag acaatttcac ggacaatact 
      61 aaagtcataa tagtacagct gaatgaaact gtacaaatta attgtacaag acccaacaac 
     121 aatacaagga aaagtataca tatgggacca ggcagagcat tttatacaac aggaataata 
     181 ggggatataa gacaagcaca ctgcaacctt agtagagcag cctggaataa cactttaaaa 
     241 caa
//
last modified: Tue May 31 10:56 2022


Questions or comments? Contact us at seq-info@lanl.gov.

 
Operated by Triad National Security, LLC for the U.S. Department of Energy's National Nuclear Security Administration
© Copyright Triad National Security, LLC. All Rights Reserved | Disclaimer/Privacy

Dept of Health & Human Services Los Alamos National Institutes of Health