View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS AF023397 243 bp DNA linear VRL 02-AUG-2001
DEFINITION HIV-1 patient 224, sample 1994, clone 3 from Italy, envelope
glycoprotein V3 region (env) gene, partial cds
ACCESSION AF023397
VERSION AF023397.1 GI:2570739
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 243)
Show all sequences for reference 1
AUTHORS Scarlatti,G., Leitner,T., Halapi,E., Wahlberg,J., Marchisio,P.,
Clerici-Schoeller,M.A., Wigzell,H., Fenyo,E.M., Albert,J., Uhlen,M.
and Rossi,P.
TITLE Comparison of variable region 3 sequences of human immunodeficiency
virus type 1 from infected children with the RNA and DNA sequences
of the virus populations of their mothers
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 90 (5), 1721-1725 (1993)
PUBMED 8446584
REFERENCE 2 (bases 1 to 243)
Show all sequences for reference 2
AUTHORS Halapi,E., Leitner,T., Jansson,M., Scarlatti,G., Orlandi,P.,
Plebani,A., Romiti,L., Albert,J., Wigzell,H. and Rossi,P.
TITLE Correlation between HIV sequence evolution, specific immune
response and clinical outcome in vertically infected infants
JOURNAL AIDS 11 (14), 1709-1717 (1997)
PUBMED 9386805
REFERENCE 3 (bases 1 to 243)
Show all sequences for reference 3
AUTHORS Halapi,E.
TITLE Direct Submission
JOURNAL Submitted (09-SEP-1997) MTC, Karolinska Institute, Doktorsringen
13, Box 280, Stockholm 171 77, Sweden
COMMENT All mothers in this study were drug users or sexual partners of
drug users.
FEATURES Location/Qualifiers
source 1..243
/organism="Human immunodeficiency virus 1"
/mol_type="genomic DNA"
/isolate="patient 224"
/db_xref="taxon:11676"
/clone="3"
/note="sample 1994 HIV-infected children attending clinics
in Milano, Italy"
gene <1..>243
/gene="env"
CDS <1..>243
/gene="env"
/note="V3 region"
/codon_start="1"
/transl_table="1"
/product="envelope glycoprotein"
/protein_id="AAB82246.1"
/db_xref="GI:2570740"
/translation="NGSLAEEEVVIKSDNFTDNTKVIIVQLNETVQINCTRPNNNTRK
SIHMGPGRAFYTTGIIGDIRQAHCNLSRAAWNNTLKQ"
BASE COUNT 107 a 41 c 46 g 49 t
ORIGIN
1 aatggcagtc tagcagaaga agaggtagta attaaatcag acaatttcac ggacaatact
61 aaagtcataa tagtacagct gaatgaaact gtacaaatta attgtacaag acccaacaac
121 aatacaagga aaagtataca tatgggacca ggcagagcat tttatacaac aggaataata
181 ggggatataa gacaagcaca ctgcaacctt agtagagcag cctggaataa cactttaaaa
241 caa
//
last modified: Tue May 31 10:56 2022