View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS KP662830 216 bp DNA linear VRL 19-NOV-2016
DEFINITION HIV-1 isolate T008-M0 tat protein (tat), vpr protein (vpr), and rev
protein (rev) genes, partial cds
ACCESSION KP662830
VERSION KP662830.1 GI:952951232
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 216)
Show all sequences for reference 1
AUTHORS Sharma,S., Ranga,U., Aralaguppe,S.P.G., Saravanan,S.,
Balakrishnan,P. and Solomon,S.
TITLE Prospective analysis of the viral evolution in the chronic phase of
HIV-1 subtype C infection
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 216)
Show all sequences for reference 2
AUTHORS Sharma,S., Aralaguppe,S.P.G., Saravanan,S., Balakrishnan,P.,
Solomon,S. and Ranga,U.
TITLE Direct Submission
JOURNAL Submitted (17-JAN-2015) Molecular Biology and Genetics unit,
JNCASR, Sri Ram pura cross, bangalore, Karnataka 560064, India
FEATURES Location/Qualifiers
source 1..216
/organism="Human immunodeficiency virus 1"
/proviral="Human immunodeficiency virus 1"
/mol_type="genomic DNA"
/isolate="T008-M0"
/host="Homo sapiens"
/db_xref="taxon:11676"
gene 1..>216
/gene="tat"
CDS 1..>216
/gene="tat"
/codon_start="1"
/transl_table="1"
/product="tat protein"
/protein_id="ALO20157.1"
/translation="MEPVDPNLEPWNHPGSQPRTACNNCFCKKCSYHCLVCFQKKGLG
ISYGRKKRRQRRSAPPSSEDHQNLIPKQ"
gene <1..20
/gene="vpr"
CDS <1..20
/gene="vpr"
/codon_start="3"
/transl_table="1"
/product="vpr protein"
/protein_id="ALO20156.1"
/translation="GASRS"
gene 140..>216
/gene="rev"
CDS 140..>216
/gene="rev"
/codon_start="1"
/transl_table="1"
/product="rev protein"
/protein_id="ALO20158.1"
/translation="MAGRSGDSDEALLRAVRIIRILYQS"
BASE COUNT 67 a 48 c 52 g 49 t
ORIGIN
1 atggagccag tagatcctaa cttagagccc tggaaccatc caggaagtca gcctagaact
61 gcttgcaata actgtttttg taaaaaatgt agctaccact gtctagtttg ctttcagaaa
121 aagggcttag gcatttccta tggcaggaag aagcggagac agcgacgaag cgctcctccg
181 agcagtgagg atcatcagaa tcttatacca aagcag
//
last modified: Tue May 31 10:56 2022