HIV Databases HIV Databases home HIV Databases home
HIV sequence database



HIV-1 ENV PROTEIN STRUCTURES INDEX


Tutorials and Museum Exhibits

(Please CHECK to make sure you have installed the CHIME plug-in into your browser and that it is functioning, before proceding)
A troubleshooting guide is available.

A tutorial on HIV-1 gp120 and Influenza hemaglutinin structure/function from the Online Macromolecular Museum at California Lutheran University.


PDB Structure Entries

Use the buttons below each entry in the list to get the PubMed entry, protein structure database (PDB) entry, open a Protein Explorer session with the entry, or get the NCBI entry (allowing Cn3D viewing) of the entry.
1G9M: Nature 1998 Jun 18;393(6686):648-59.
HIV-1 (clone HXB2) gp120 (with variable loops replaced by short linker peptides) bound to neutralizing antibody 17B and CD4 receptor.

1G9N: Nature 1998 Jun 18;393(6686):648-59.
HIV-1 (clone YU-2) gp120 (with vairable loops replaced by short linker peptides) bound to neutralizing antibody 17B and CD4 receptor.

1GC1: Nature 1998 Jun 18;393(6686):648-59.
HIV-1 (clone HXB2 with K403E mutation) gp120 (with vairable loops replaced by short linker peptides) bound to neutralizing antibody 17B and CD4 receptor. K403E is position 232 in this structure.

1QBZ: J Struct Biol 1999 Jun 15;126(2):131-44.
HIV-1 gp41 ectodomain core, trimer of 2 helices each at 1.47 Angstroms.

1AIK: Cell 1997 Apr 18;89(2):263-73.
HIV-1 gp41 ectodomain core.

1ENV: Cell 1997 Apr 18;89(2):263-73.
HIV-1 gp41 ectodomain core.

1SZT: Cell 1997 Apr 18;89(2):263-73.
HIV-1 gp41 ectodomain core.

1I5Y: J Virol 2001 Nov;75(22):11146-56.
HIV-1 gp41 ectodomain core.

1I5X: J Virol 2001 Nov;75(22):11146-56.
HIV-1 gp41 ectodomain coree.

1JQ0: J Biol Chem 2002 Apr 12;277(15):12891-900.
SIV in vitro-derived variant of SIVmac251, denoted CPmac, gp41 ectodomain core.

1JPX: J Biol Chem 2002 Apr 12;277(15):12891-900.
SIVmac251, gp41 ectodomain core.

1ACY: Science. 1994 Apr 1;264(5155):82-5.
Crystal structure of the principal neutralization site (YNKRKRIHIGPGRAFYTTKNIIGC; 301-325 in HXB2 gp160) of HIV-1 (clone MN), bound to antibody.

1F58: Structure Fold Des. 1999 Feb 15;7(2):131-42.
Crystal structure of the principal neutralization site (YNKRKRIHIGPGRXFYTTKNIIGC; 301-325 in HXB2 gp160) of HIV-1 (clone MN with Ala To AIB (ALPHA-AMINOISOBUTYRIC ACID) substitution at position 315), bound to antibody. Position 315 in HXB2 gp160 is 323 in MN.

2F58: Structure Fold Des. 1999 Feb 15;7(2):131-42.
Crystal structure of a cyclic peptide (-HIGPGRAFGGG-; 308-320 in HXB2 gp160) of HIV-1 (clone MN) bound to antibody.

3F58: Structure Fold Des. 1999 Feb 15;7(2):131-42.
Crystal structure of a cyclic peptide (-SIGPGRAFGGG-; 308-320 in HXB2 gp160) of HIV-1 (clone MN with H308S mutation) bound to antibody.

1B03: Biochemistry. 1997 Jul 15;36(28):8619-27. Nat Struct Biol. 1999 Apr;6(4):331-5.
Crystal structure of the principal neutralization site (XKSIRIQRGPGRAFVTIG; 304-321 in HXB2 gp160) of HIV-1 (clone HXB2 with Arg to Ser substitution at position 306), bound to antibody.

1CE4: FEBS Lett 1995 Oct 23;374(1):117-21
Conformational model of HIV-1 (consensus) V3 loop (CTRPNNNTRKSIHIGPGRAFYTTGEIIGDIRQAHC), 20 NMR structures. Cysteines linked with disulfide bond.

1GGI: Proteins 1992 Dec;14(4):499-508
Crystal structure of a human immunodeficiency virus type 1 neutralizing antibody, IgG2 Fab Fragment (50.1) in complex with its V3 loop peptide antigen (CKRIHIGPGRAFYTTC).

1GGB: Proteins 1992 Dec;14(4):499-508
Crystal structure of a human immunodeficiency virus type 1 neutralizing antibody, IgG2 Fab Fragment (50.1).

1GGC: Proteins 1992 Dec;14(4):499-508
Crystal structure of a human immunodeficiency virus type 1 neutralizing antibody, IgG2 Fab Fragment (50.1).

1QNZ: Proteins 1992 Dec;14(4):499-508.
NMR minimized average structure of a neutralizing antibody 0.5B, complexed with a HIV-1 (clone LAI, same as HXB2 except for R306S mutation) V3 peptide (RKSIRIQRGPGRAFVTIG).

1HHG: Proc Natl Acad Sci U S A. 1992 Apr 15;89(8):3429-33. J Mol Biol. 1985 Nov 5;186(1):205-10. J Mol Biol. 1991 May 20;219(2):277-319. Nature. 1987 Oct 8-14;329(6139):512-8. Cell. 1992 Sep 18;70(6):1035-48. Nature. 1987 Oct 8-14;329(6139):506-12.
Human class I histocompatibility antigen (Hla-A 0201) in complex with a 9 amino acid HIV-1 gp120 env peptide (TLTSCNTSV; residues 192-200 in HXB2).

1MEQ: Eur J Biochem 2002 Oct;269(19):4860-7.
NMR minimized average structure of HIV gp120 C5 domain (VKIEPLGVAPTKTKRRVVQREKR), (residues 489-511 in gp160 of clone HXB2).

1NIZ: Structure (Camb). 2003 Feb;11(2):225-36.
HIV-1 (Mn Isolate) V3 Peptide Bound to A Human Neutralizing Antibody 447-52D, NMR minimized average structure of V3 only, not Antibody.

1NJ0: Structure (Camb). 2003 Feb;11(2):225-36.
HIV-1 (Mn Isolate) V3 Peptide Bound to A Human Neutralizing Antibody 447-52D, NMR 29 structures of V3 only, not Antibody.

1DFB: Proc Natl Acad Sci U S A. 1992 Aug 1;89(15):7154-8. and J Mol Biol. 1990 Dec 5;216(3):511-2.
HIV-1 gp41 complexed with human monoclonal antibody Fab 3D6 fragment.

2SIV: Proc Natl Acad Sci U S A. 1998 Aug 4;95(16):9134-9. and Cell. 1997 Apr 18;89(2):263-73.
SIV-SMM gp41 core structure.

1JEK: Proc Natl Acad Sci U S A. 1998 Aug 4;95(16):9134-9. and Cell. 1997 Apr 18;89(2):263-73.
Visna Virus Envelope Transmembrane Region core structure.


Envelope-related Structures

1MG1: Proc Natl Acad Sci U S A. 1999 Apr 13;96(8):4319-24. Protein Sci. 1998 Jul;7(7):1612-9.
HTLV-I Env gp21 ectodomain.
2EBO: Proc Natl Acad Sci U S A. 1999 Mar 16;96(6):2662-7. Proc Natl Acad Sci U S A. 1998 Aug 4;95(16):9134-9. and Cell. 1997 Apr 18;89(2):263-73.
Visna Virus Envelope Transmembrane Region core structure.


Publications on Envelope Structures

The Glycosylation of Env
Zhu X, Borchers C, Bienstock RJ, Tomer KB.
Mass spectrometric characterization of the glycosylation pattern of HIV-gp120 expressed in CHO cells.
Biochemistry 2000 Sep 19;39(37):11194-204.
PMID: 10985765

The gp41 core domain and its role in virus/cell fusion
Yang ZN, Mueser TC, Kaufman J, Stahl SJ, Wingfield PT, Hyde CC.
The crystal structure of the SIV gp41 ectodomain at 1.47 A resolution.
J Struct Biol 1999 Jun 15;126(2):131-44.
PMID: 10388624

Antibody neutralization and escape by HIV-1
Wei X, Decker JM, Wang S, Hui H, Kappes JC, Wu X, Salazar-Gonzalez JF, Salazar MG, Kilby JM, Saag MS, Komarova NL, Nowak MA, Hahn BH, Kwong PD, Shaw GM.
Antibody neutralization and escape by HIV-1.
Nature. 2003 Mar 20;422(6929):307-12.
PMID: 12646921


last modified: Thu Nov 12 10:04 2009


Questions or comments? Contact us at seq-info@lanl.gov.

 
Operated by Los Alamos National Security, LLC, for the U.S. Department of Energy's National Nuclear Security Administration
Copyright © 2005-2006 LANSLLC All rights reserved | Disclaimer/Privacy

Dept of Health & Human Services Los Alamos National Institutes of Health