Found 1 matching record:
Download this epitope record as JSON.
MAb ID | 3D9 | |
---|---|---|
HXB2 Location | Env(578-612) DNA(7956..8060) |
Env Epitope Map |
Author Location | gp41(579-613 BH10) | |
Research Contact | H. Katinger, Inst. Appl. Microbiol., Vienna, Austria | |
Epitope |
ARILAVERYLKDQQLLGIWGCSGKLICTTAVPWNA
|
Epitope Alignment |
Subtype | B | |
Ab Type | ||
Neutralizing | ||
Species (Isotype) | human(IgG1κ) | |
Patient | ||
Immunogen | HIV-1 infection | |
Keywords | antibody generation, review |
Showing 2 of 2 notes.
Showing 3 of 3 references.
Isolation Paper
Buchacher1994
A. Buchacher, R. Predl, K. Strutzenberger, W. Steinfellner, A. Trkola, M. Purtscher, G. Gruber, C. Tauer, F. Steindl, A. Jungbauer, and H. Katinger. Generation of Human Monoclonal Antibodies against HIV-1 Proteins; Electrofusion and Epstein-Barr Virus Transformation for Peripheral Blood Lymphocyte Immortalization. AIDS Res. Hum. Retroviruses, 10:359-369, 1994. A panel of 33 human monoclonal antibodies were produced. Linear epitopes for some of this set of MAbs were mapped using peptide ELISA. Linear epitopes were mapped in gp41, and a single epitope was mapped in p24. While multiple gp120 specific MAbs were generated, all seemed to be conformational or carbohydrate dependent, or both. PubMed ID: 7520721.
Show all entries for this paper.
Buchacher1992 Andrea Buchacher, Renate Predl, Christa Tauer, Martin Purtscher, Gerhard Gruber, Renate Heider, Fraz Steindl, Alexandra Trkola, Alois Jungbauer, and Herman Katinger. Human Monoclonal Antibodies against gp41 and gp120 as Potential Agent for Passive Immunization. Vaccines, 92:191-195, 1992. Show all entries for this paper.
Gorny2003 Miroslaw K. Gorny and Susan Zolla-Pazner. Human Monoclonal Antibodies that Neutralize HIV-1. In Bette T. M. Korber and et. al., editors, HIV Immunology and HIV/SIV Vaccine Databases 2003. pages 37--51. Los Alamos National Laboratory, Theoretical Biology \& Biophysics, Los Alamos, N.M., 2004. URL: http://www.hiv.lanl.gov/content/immunology/pdf/2003/zolla-pazner_article.pdf. LA-UR 04-8162. Show all entries for this paper.
This is a legacy search page. It is deprecated, will receive no more updates, and will eventually be removed. Please use the new search pages.