View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS HIVU80555 216 bp DNA linear VRL 03-DEC-1998
DEFINITION HIV-1 patient LTS16, sample 1995, tat protein (tat) gene, partial
cds
ACCESSION U80555
VERSION U80555.1 GI:1750004
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 216)
Show all sequences for reference 1
AUTHORS Quinones-Mateu,M.E., Mas,A., Lain de Lera,T., Soriano,V.,
Alcami,J., Lederman,M.M. and Domingo,E.
TITLE LTR and tat variability of HIV-1 isolates from patients with
divergent rates of disease progression
JOURNAL Virus Res. 57 (1), 11-20 (1998)
PUBMED 9833881
REFERENCE 2 (bases 1 to 216)
Show all sequences for reference 2
AUTHORS Quinones-Mateu,M.E.
TITLE Direct Submission
JOURNAL Submitted (29-NOV-1996) Centro de Biologia Molecular ''Severo
Ochoa'', Universidad Autonoma de Madrid, Madrid 28049, Spain
FEATURES Location/Qualifiers
source 1..216
/organism="Human immunodeficiency virus 1"
/proviral="Human immunodeficiency virus 1"
/mol_type="genomic DNA"
/isolate="patient LTS16"
/db_xref="taxon:11676"
/note="sample 1995"
gene 1..>216
/gene="tat"
CDS 1..>216
/gene="tat"
/note="first exon"
/codon_start="1"
/transl_table="1"
/product="tat protein"
/protein_id="AAC82994.1"
/db_xref="GI:1750005"
/translation="MEPVDPRLEPWKHPGSQPKTACTNCYCKRCCLHCQVCFTTKGLG
ISYGRKKRRQRRRAPQDRQTNQVSLSKQ"
BASE COUNT 66 a 50 c 51 g 49 t
ORIGIN
1 atggagccag tagatcctag actagagccc tggaagcatc caggaagtca acctaagact
61 gcttgtacca attgctattg taagaggtgt tgcttacatt gtcaagtttg cttcacaaca
121 aaaggcttag gcatctccta tggcaggaag aagcggagac agcgacgacg agctcctcaa
181 gaccgtcaga ctaatcaagt ttctctatca aagcag
//
last modified: Tue May 31 10:56 2022