HIV Databases HIV Databases home HIV Databases home
HIV Sequence Database



Download: ENTIRE SEQUENCE SEQUENCE FRAGMENT start end
Format:  
View NCBI entry		Download GenBank file		Graphics View		Download GFF3 File

LOCUS	    HIV1U35989		     653 bp    DNA     linear	VRL 25-APR-1996
DEFINITION  Human immunodeficiency virus type 1 sample P3.22-3, envelope
	    glycoprotein (env) gene, C2-V5, partial cds
ACCESSION   U35989
VERSION     U35989.1 GI:1144796
KEYWORDS    .
SOURCE	    Human immunodeficiency virus 1 (HIV-1)
  ORGANISM  Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
	    Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
	    group
REFERENCE   1 (bases 1 to 653)
            Show all sequences for reference 1
  AUTHORS   McDonald,D.
  TITLE     Direct Submission
  JOURNAL   Submitted (12-SEP-1995) D. McDonald, Theoretical Biology, T-10, Los
	    Alamos National Lab, Los Alamos, NM 87545, USA
REFERENCE   2
            Show all sequences for reference 2
  AUTHORS   Wolinsky,S.M., Korber,B.T., Neumann,A.U., Daniels,M.,
	    Kunstman,K.J., Whetsell,A.J., Furtado,M.R., Cao,Y., Ho,D.D.,
	    Safrit,J.T. and Koup,R.A.
  TITLE     Adaptive evolution of human immunodeficiency virus-type 1 during
	    the natural course of infection
  JOURNAL   Science 272 (5261), 537-542 (1996)
  PUBMED    8614801
REFERENCE   3
            Show all sequences for reference 3
  AUTHORS   Kils-Hutten,L., Cheynier,R., Wain-Hobson,S. and Meyerhans,A.
  TITLE     Phylogenetic reconstruction of intrapatient evolution of human
	    immunodeficiency virus type 1: predominance of drift and purifying
	    selection.
  JOURNAL   J Gen Virol. 2001 Jul;82(Pt 7):1621-7.
  PUBMED    11413373
COMMENT     Sequence related to longitudinal study of HIV genetic variation and
	    its relation to rate of disease progression. These patients are
	    from the Chicago MACS cohort. In the study, P1 & P2 were rapid
	    progressors, P3 & P4 normal progressors, and P5 & P6
	    non-progressors. Their estimated years of seroconversion are as
	    follows: for P1, 1985, for P2, 1985, for P3, 1986, for P4, 1986,
	    for P5, 1985, and for P6, 1984. In the sample number, Px.y-z, x
	    stands for the patient number, y is the number of months after the
	    estimated date of seroconversion, and z is the clone number.
	    Patient P3 has a moderate rate of disease progression. Samples
	    available are (months after seroconversion indicated): 7 months (8
	    clones), 10 months (6 clones), 22 months (5 clones), 25 months (6
	    clones), 49 months (5 clones).
FEATURES             Location/Qualifiers
     source	     1..653
		     /organism="Human immunodeficiency virus 1"
		     /proviral="Human immunodeficiency virus 1"
		     /mol_type="genomic DNA"
		     /isolate="sample P3.22-3"
		     /db_xref="taxon:11676"
		     /note="PCR amplified proviral DNA from peripheral blood
		     mononuclear cells"
     gene	     1..410
		     /gene="env"
     CDS	     <1..410
		     /gene="env"
		     /note="C2-V5"
		     /codon_start="3"
		     /transl_table="1"
		     /product="envelope glycoprotein"
		     /protein_id="AAA97684.1"
		     /db_xref="GI:1144797"
		     /translation="GSLAEEEVVLRSDNFSDNAKIIIVQLNETVEINCTRPNNNTRKS
		     IHIRPRRAFYTTGNIIRNIRQAHCNISSTKWNNTLKLIVEKLKEQFRNKTIVFNQSSG
		     EDPEIVMHSFNCGREFFYCDSTPLFNSTWSNGP"
BASE COUNT	277 a	  96 c	  123 g    157 t
ORIGIN
       1 atggcagtct agcagaagaa gaggtggtac ttagatctga caatttctcg gacaatgcta 
      61 aaatcataat agtacagctg aatgaaacag tagaaattaa ttgtacaaga cccaacaaca 
     121 atacaaggaa aagtatacat ataagaccaa ggagagcatt ttatacaaca ggaaacataa 
     181 taagaaatat aagacaagca cattgtaaca ttagtagtac aaaatggaat aacactttaa 
     241 aactaatagt tgaaaaatta aaagaacaat ttaggaataa aacaatagtc tttaatcaat 
     301 cctcaggaga ggacccagaa attgtaatgc acagttttaa ttgtggaagg gaatttttct 
     361 actgtgattc aacaccactg tttaatagta cttggtctaa tggtccttag aaaggtactg 
     421 aagaaaataa cacaatcaca ctccaatgca agataaaaca aattataaac atgtggcaga 
     481 aagtaagaaa agcaatgtat gcccctccca tcagaggaca aattagatgt tcatcaaata 
     541 ttacagggtt gctattaaca agagatagta gtaatagtag cgaaagcacc gaggtcctca 
     601 gacctggagg aggagatatg aaggacaatt ggagaagtga attatataaa tat
//
last modified: Tue May 31 10:56 2022


Questions or comments? Contact us at seq-info@lanl.gov.