View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS HIV1U35989 653 bp DNA linear VRL 25-APR-1996
DEFINITION Human immunodeficiency virus type 1 sample P3.22-3, envelope
glycoprotein (env) gene, C2-V5, partial cds
ACCESSION U35989
VERSION U35989.1 GI:1144796
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 653)
Show all sequences for reference 1
AUTHORS McDonald,D.
TITLE Direct Submission
JOURNAL Submitted (12-SEP-1995) D. McDonald, Theoretical Biology, T-10, Los
Alamos National Lab, Los Alamos, NM 87545, USA
REFERENCE 2
Show all sequences for reference 2
AUTHORS Wolinsky,S.M., Korber,B.T., Neumann,A.U., Daniels,M.,
Kunstman,K.J., Whetsell,A.J., Furtado,M.R., Cao,Y., Ho,D.D.,
Safrit,J.T. and Koup,R.A.
TITLE Adaptive evolution of human immunodeficiency virus-type 1 during
the natural course of infection
JOURNAL Science 272 (5261), 537-542 (1996)
PUBMED 8614801
REFERENCE 3
Show all sequences for reference 3
AUTHORS Kils-Hutten,L., Cheynier,R., Wain-Hobson,S. and Meyerhans,A.
TITLE Phylogenetic reconstruction of intrapatient evolution of human
immunodeficiency virus type 1: predominance of drift and purifying
selection.
JOURNAL J Gen Virol. 2001 Jul;82(Pt 7):1621-7.
PUBMED 11413373
COMMENT Sequence related to longitudinal study of HIV genetic variation and
its relation to rate of disease progression. These patients are
from the Chicago MACS cohort. In the study, P1 & P2 were rapid
progressors, P3 & P4 normal progressors, and P5 & P6
non-progressors. Their estimated years of seroconversion are as
follows: for P1, 1985, for P2, 1985, for P3, 1986, for P4, 1986,
for P5, 1985, and for P6, 1984. In the sample number, Px.y-z, x
stands for the patient number, y is the number of months after the
estimated date of seroconversion, and z is the clone number.
Patient P3 has a moderate rate of disease progression. Samples
available are (months after seroconversion indicated): 7 months (8
clones), 10 months (6 clones), 22 months (5 clones), 25 months (6
clones), 49 months (5 clones).
FEATURES Location/Qualifiers
source 1..653
/organism="Human immunodeficiency virus 1"
/proviral="Human immunodeficiency virus 1"
/mol_type="genomic DNA"
/isolate="sample P3.22-3"
/db_xref="taxon:11676"
/note="PCR amplified proviral DNA from peripheral blood
mononuclear cells"
gene 1..410
/gene="env"
CDS <1..410
/gene="env"
/note="C2-V5"
/codon_start="3"
/transl_table="1"
/product="envelope glycoprotein"
/protein_id="AAA97684.1"
/db_xref="GI:1144797"
/translation="GSLAEEEVVLRSDNFSDNAKIIIVQLNETVEINCTRPNNNTRKS
IHIRPRRAFYTTGNIIRNIRQAHCNISSTKWNNTLKLIVEKLKEQFRNKTIVFNQSSG
EDPEIVMHSFNCGREFFYCDSTPLFNSTWSNGP"
BASE COUNT 277 a 96 c 123 g 157 t
ORIGIN
1 atggcagtct agcagaagaa gaggtggtac ttagatctga caatttctcg gacaatgcta
61 aaatcataat agtacagctg aatgaaacag tagaaattaa ttgtacaaga cccaacaaca
121 atacaaggaa aagtatacat ataagaccaa ggagagcatt ttatacaaca ggaaacataa
181 taagaaatat aagacaagca cattgtaaca ttagtagtac aaaatggaat aacactttaa
241 aactaatagt tgaaaaatta aaagaacaat ttaggaataa aacaatagtc tttaatcaat
301 cctcaggaga ggacccagaa attgtaatgc acagttttaa ttgtggaagg gaatttttct
361 actgtgattc aacaccactg tttaatagta cttggtctaa tggtccttag aaaggtactg
421 aagaaaataa cacaatcaca ctccaatgca agataaaaca aattataaac atgtggcaga
481 aagtaagaaa agcaatgtat gcccctccca tcagaggaca aattagatgt tcatcaaata
541 ttacagggtt gctattaaca agagatagta gtaatagtag cgaaagcacc gaggtcctca
601 gacctggagg aggagatatg aaggacaatt ggagaagtga attatataaa tat
//
last modified: Tue May 31 10:56 2022