View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS HIV1U35977 662 bp DNA linear VRL 25-APR-1996
DEFINITION Human immunodeficiency virus type 1 sample P2.9-21, envelope
glycoprotein (env) gene, C2-V5, partial cds
ACCESSION U35977
VERSION U35977.1 GI:1144772
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 662)
Show all sequences for reference 1
AUTHORS McDonald,D.
TITLE Direct Submission
JOURNAL Submitted (12-SEP-1995) D. McDonald, Theoretical Biology, T-10, Los
Alamos National Lab, Los Alamos, NM 87545, USA
REFERENCE 2
Show all sequences for reference 2
AUTHORS Wolinsky,S.M., Korber,B.T., Neumann,A.U., Daniels,M.,
Kunstman,K.J., Whetsell,A.J., Furtado,M.R., Cao,Y., Ho,D.D.,
Safrit,J.T. and Koup,R.A.
TITLE Adaptive evolution of human immunodeficiency virus-type 1 during
the natural course of infection
JOURNAL Science 272 (5261), 537-542 (1996)
PUBMED 8614801
REFERENCE 3
Show all sequences for reference 3
AUTHORS Kils-Hutten,L., Cheynier,R., Wain-Hobson,S. and Meyerhans,A.
TITLE Phylogenetic reconstruction of intrapatient evolution of human
immunodeficiency virus type 1: predominance of drift and purifying
selection.
JOURNAL J Gen Virol. 2001 Jul;82(Pt 7):1621-7.
PUBMED 11413373
COMMENT Sequence related to longitudinal study of HIV genetic variation and
its relation to rate of disease progression. These patients are
from the Chicago MACS cohort. In the study, P1 & P2 were rapid
progressors, P3 & P4 normal progressors, and P5 & P6
non-progressors. Their estimated years of seroconversion are as
follows: for P1, 1985, for P2, 1985, for P3, 1986, for P4, 1986,
for P5, 1985, and for P6, 1984. In the sample number, Px.y-z, x
stands for the patient number, y is the number of months after the
estimated date of seroconversion, and z is the clone number. This
patient, P2, is a rapid progressor. P2 sequences available are
(dates after seroconversion indicated): 3 months (6 clones), 9
months (6 clones), 15 months (7 clones), 18 months (7 clones), 21
months (7 clones), 27 months (7 clones), 31 months (5 clones).
FEATURES Location/Qualifiers
source 1..662
/organism="Human immunodeficiency virus 1"
/proviral="Human immunodeficiency virus 1"
/mol_type="genomic DNA"
/isolate="sample P2.9-21"
/db_xref="taxon:11676"
/note="PCR amplified proviral DNA from peripheral blood
mononuclear cells"
gene 1..662
/gene="env"
CDS <1..>662
/gene="env"
/note="C2-V5"
/codon_start="3"
/transl_table="1"
/product="envelope glycoprotein"
/protein_id="AAA97672.1"
/db_xref="GI:1144773"
/translation="GSLAEEEVIIRSENFTNNARTIIVQLKEPVEINCTRPNNNTRKG
IHIGPGRAFYTTGEIIGNIRQAHCNISKAKWNNTLKQIVTKLREQFGNKTIVFNQSSG
GDPEIVMHSFNCGGEFFYCNSTQLFNSTWNDTDGSNNTEGNNTLITLPCKIKQVINLW
QEVGKAMYAPPIRGQIRCSSNITGLLLTRDGGSNENNKTEIFRPGGGDMRDNWRSELY
KY"
BASE COUNT 275 a 103 c 136 g 148 t
ORIGIN
1 atggcagtct agcagaagaa gaggtaataa ttagatctga aaatttcacg aacaatgcaa
61 gaaccataat agtacagctg aaagaacctg tagaaattaa ttgtacaaga cccaacaaca
121 atacaagaaa aggtatacat ataggaccag ggagagcatt ctatacaaca ggagaaataa
181 taggaaacat aagacaagca cattgtaaca ttagtaaggc aaaatggaat aacactttaa
241 aacagatagt tacaaaatta agagaacaat ttgggaataa aacaatagtc tttaaccaat
301 cctcaggagg ggacccagaa attgtaatgc acagttttaa ttgtggaggg gaatttttct
361 actgtaattc aacacaactg tttaatagta cttggaatga tactgacggg tcaaataaca
421 ctgaaggaaa taacacactc atcacactcc catgcaaaat aaaacaagtt ataaacctgt
481 ggcaggaagt aggaaaagca atgtatgccc ctcccatcag aggacaaatt agatgttcat
541 caaatattac agggttgcta ttaacaagag atggtggtag taacgagaac aacaagaccg
601 agatcttcag acctggggga ggagatatga gggacaattg gagaagtgaa ttgtataaat
661 at
//
last modified: Tue May 31 10:56 2022