HIV Databases HIV Databases home HIV Databases home
HIV Sequence Database



Download: ENTIRE SEQUENCE SEQUENCE FRAGMENT start end
Format:  
View NCBI entry		Download GenBank file		Graphics View		Download GFF3 File

LOCUS	    HIV1U35971		     656 bp    DNA     linear	VRL 04-FEB-1997
DEFINITION  Human immunodeficiency virus type 1 sample P2.31-8, envelope
	    glycoprotein (env) gene, C2-V5, partial cds
ACCESSION   U35971
VERSION     U35971.1 GI:1144760
KEYWORDS    .
SOURCE	    Human immunodeficiency virus 1 (HIV-1)
  ORGANISM  Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
	    Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
	    group
REFERENCE   1 (bases 1 to 656)
            Show all sequences for reference 1
  AUTHORS   Wolinsky,S.M., Korber,B.T., Neumann,A.U., Daniels,M.,
	    Kunstman,K.J., Whetsell,A.J., Furtado,M.R., Cao,Y., Ho,D.D.,
	    Safrit,J.T. and Koup,R.A.
  TITLE     Adaptive evolution of human immunodeficiency virus-type 1 during
	    the natural course of infection
  JOURNAL   Science 272 (5261), 537-542 (1996)
  PUBMED    8614801
REFERENCE   2 (bases 1 to 656)
            Show all sequences for reference 2
  AUTHORS   McDonald,D.
  TITLE     Direct Submission
  JOURNAL   Submitted (12-SEP-1995) D. McDonald, Theoretical Biology, T-10, Los
	    Alamos National Lab, Los Alamos, NM 87545, USA
REFERENCE   3
            Show all sequences for reference 3
  AUTHORS   Kils-Hutten,L., Cheynier,R., Wain-Hobson,S. and Meyerhans,A.
  TITLE     Phylogenetic reconstruction of intrapatient evolution of human
	    immunodeficiency virus type 1: predominance of drift and purifying
	    selection.
  JOURNAL   J Gen Virol. 2001 Jul;82(Pt 7):1621-7.
  PUBMED    11413373
COMMENT     Sequence related to longitudinal study of HIV genetic variation and
	    its relation to rate of disease progression. These patients are
	    from the Chicago MACS cohort. In the study, P1 & P2 were rapid
	    progressors, P3 & P4 normal progressors, and P5 & P6
	    non-progressors. Their estimated years of seroconversion are as
	    follows: for P1, 1985, for P2, 1985, for P3, 1986, for P4, 1986,
	    for P5, 1984, and for P6, 1985. In the sample number, Px.y-z, x
	    stands for the patient number, y is the number of months after the
	    estimated date of seroconversion, and z is the clone number. This
	    patient, P2, is a rapid progressor. P2 sequences available are
	    (dates after seroconversion indicated): 3 months (6 clones), 9
	    months (6 clones), 15 months (7 clones), 18 months (7 clones), 21
	    months (7 clones), 27 months (7 clones), 31 months (5 clones).
FEATURES             Location/Qualifiers
     source	     1..656
		     /organism="Human immunodeficiency virus 1"
		     /proviral="Human immunodeficiency virus 1"
		     /mol_type="genomic DNA"
		     /isolate="sample P2.31-8"
		     /db_xref="taxon:11676"
		     /note="PCR amplified proviral DNA from peripheral blood
		     mononuclear cells"
     gene	     1..656
		     /gene="env"
     CDS	     <1..>656
		     /gene="env"
		     /note="C2-V5"
		     /codon_start="3"
		     /transl_table="1"
		     /product="envelope glycoprotein"
		     /protein_id="AAB41933.1"
		     /db_xref="GI:1144761"
		     /translation="GSLAXEEIIIRSENFTNNAKTIIVQLNEPVEINCTRPNNNTRKG
		     IHVGPGRAFYTTGDIIGNIRQAHCNISKAKWDNTLKQIVTKLREQFGNKTIVFNQSSG
		     GDPEIVMHSFNCGGEFFYCNSTQLFNSTWNNTDGSNNTEGNITLPCRIKQIINLWQEV
		     GKAMYAPPIRGQIRCSSNITGLLLTRDGGSNEDNNMTEIFRPGGGDMRDNWRSELYKY
		     "
BASE COUNT	268 a	 101 c	  136 g    150 t      1 other
ORIGIN
       1 atggcagtct agcagnagaa gagataataa ttagatctga aaacttcacg aacaatgcaa 
      61 aaaccataat agtacagctg aatgaacctg tagaaattaa ttgtacaaga cccaacaaca 
     121 atacaagaaa aggtatacat gtaggaccag ggagagcatt ctatacaaca ggagatataa 
     181 taggaaacat aagacaagca cattgtaaca ttagtaaggc caaatgggat aacactttaa 
     241 aacagatagt tacaaaatta agagaacaat ttgggaataa aacaatagtc tttaaccaat 
     301 cctcaggagg ggacccagaa attgtaatgc acagttttaa ttgtggaggg gaatttttct 
     361 actgtaattc aacacaactg tttaatagta cttggaataa tactgacggg tcaaataaca 
     421 ctgaaggaaa tatcacactc ccatgtagaa taaaacaaat tataaacctg tggcaggaag 
     481 taggaaaagc aatgtatgcc cctcccatca gaggacaaat tagatgttca tcaaatatta 
     541 cagggttgct attaacaaga gatggtggta gtaacgagga caacaacatg accgagatct 
     601 tcagacctgg gggaggagat atgagggaca attggagaag tgaattgtat aaatat
//
last modified: Tue May 31 10:56 2022


Questions or comments? Contact us at seq-info@lanl.gov.