HIV Databases HIV Databases home HIV Databases home
HIV Sequence Database



Download: ENTIRE SEQUENCE SEQUENCE FRAGMENT start end
Format:  
View NCBI entry		Download GenBank file		Graphics View		Download GFF3 File

LOCUS	    HIV1U24790		     242 bp    DNA     linear	VRL 03-SEP-1996
DEFINITION  Human immunodeficiency virus type 1 envelope glycoprotein (env)
	    gene, V3 region, clone sCbu3.16, partial cds
ACCESSION   U24790
VERSION     U24790.1 GI:818374
KEYWORDS    .
SOURCE	    Human immunodeficiency virus 1 (HIV-1)
  ORGANISM  Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
	    Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
	    group
REFERENCE   1 (bases 1 to 242)
            Show all sequences for reference 1
  AUTHORS   Briant,L., Wade,C.M., Puel,J., Brown,A.J. and Guyader,M.
  TITLE     Analysis of envelope sequence variants suggests multiple mechanisms
	    of mother-to-child transmission of human immunodeficiency virus
	    type 1
  JOURNAL   J. Virol. 69 (6), 3778-3788 (1995)
  PUBMED    7745725
REFERENCE   2 (bases 1 to 242)
            Show all sequences for reference 2
  AUTHORS   Briant,L., Wade,C.M., Puel,J., Leigh Brown,A.J. and Guyader,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-APR-1995) Chris M. Wade, Centre for HIV Research,
	    ICAPB, Division of Biological Sciences, University of Edinburgh,
	    King''s Buildings, West Mains Road, Edinburgh, EH9 3JN, Scotland,
	    United Kingdom
COMMENT     V3-ID: B_FR1.ID These 4 sequences are from Toulouse, France. In
	    this study, 4 mother-infant pairs were followed during pregnancy
	    and after birth. The inter- and intra-patient sequence similarities
	    of this set of 308 sequences has been controversial, because some
	    infant sequences were identical to sequences from other mothers.
	    For purposes of this V3 section, only one sequence from each of the
	    4 infants is presented here. (Briant95), (Korber95) and (Learn96).
	    GenBank entries for all 308 sequences are found with accession
	    numbers U24717-U24999 and U25001-U25025
FEATURES             Location/Qualifiers
     source	     1..242
		     /organism="Human immunodeficiency virus 1"
		     /proviral="Human immunodeficiency virus 1"
		     /mol_type="genomic DNA"
		     /isolate="Child A: 2.5 months"
		     /db_xref="taxon:11676"
		     /clone="sCbu3.16"
     gene	     1..242
		     /gene="env"
     CDS	     <1..>242
		     /gene="env"
		     /codon_start="2"
		     /transl_table="1"
		     /product="envelope glycoprotein, V3 region"
		     /protein_id="AAB07216.1"
		     /db_xref="GI:818375"
		     /translation="EVVIRSENFTNNAKTIIVQLKESVEINCTRLSNNTRRSINIGPG
		     RAFYTTGAIIGDIRQAHCNISRVKWNNTLKQIVGKL"
BASE COUNT	109 a	  28 c	   47 g     58 t
ORIGIN
       1 agaggtagta attaggtctg aaaatttcac gaataatgct aaaaccataa tagtacagct 
      61 gaaagaatct gtagaaatta attgtacaag actcagcaat aatacaagaa gaagtataaa 
     121 tataggacca gggagagcat tttatacaac aggagctata ataggagata taagacaagc 
     181 acattgtaac attagtagag taaaatggaa taacacttta aaacagatag ttggcaaatt 
     241 ag
//
last modified: Tue May 31 10:56 2022


Questions or comments? Contact us at seq-info@lanl.gov.