HIV Databases HIV Databases home HIV Databases home
HIV Sequence Database



Download: ENTIRE SEQUENCE SEQUENCE FRAGMENT start end
Format:  
View NCBI entry		Download GenBank file		Graphics View		Download GFF3 File

LOCUS	    HIV1U24724		     319 bp    DNA     linear	VRL 03-SEP-1996
DEFINITION  Human immunodeficiency virus type 1 envelope glycoprotein (env)
	    gene, V3 region, clone Mbu1.22, partial cds
ACCESSION   U24724
VERSION     U24724.1 GI:818242
KEYWORDS    .
SOURCE	    Human immunodeficiency virus 1 (HIV-1)
  ORGANISM  Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
	    Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
	    group
REFERENCE   1 (bases 1 to 319)
            Show all sequences for reference 1
  AUTHORS   Briant,L., Wade,C.M., Puel,J., Brown,A.J. and Guyader,M.
  TITLE     Analysis of envelope sequence variants suggests multiple mechanisms
	    of mother-to-child transmission of human immunodeficiency virus
	    type 1
  JOURNAL   J. Virol. 69 (6), 3778-3788 (1995)
  PUBMED    7745725
REFERENCE   2 (bases 1 to 319)
            Show all sequences for reference 2
  AUTHORS   Briant,L., Wade,C.M., Puel,J., Leigh Brown,A.J. and Guyader,M.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-APR-1995) Chris M. Wade, Centre for HIV Research,
	    ICAPB, Division of Biological Sciences, University of Edinburgh,
	    King''s Buildings, West Mains Road, Edinburgh, EH9 3JN, Scotland,
	    United Kingdom
COMMENT     B_FR1.ID These 4 sequences are from Toulouse, France. In this
	    study, 4 mother-infant pairs were followed during pregnancy and
	    after birth. The inter- and intra-patient sequence similarities of
	    this set of 308 sequences has been controversial, because some
	    infant sequences were identical to sequences from other mothers.
	    For purposes of this V3 section, only one sequence from each of the
	    4 infants is presented here. (Briant95), (Korber95) and (Learn96).
	    GenBank entries for all 308 sequences are found with accession
	    numbers U24717-U24999 and U25001-U25025
FEATURES             Location/Qualifiers
     source	     1..319
		     /organism="Human immunodeficiency virus 1"
		     /proviral="Human immunodeficiency virus 1"
		     /mol_type="genomic DNA"
		     /isolate="Mother A: 3.5 months pregnancy"
		     /db_xref="taxon:11676"
		     /clone="Mbu1.22"
     gene	     1..319
		     /gene="env"
     CDS	     <1..>319
		     /gene="env"
		     /codon_start="1"
		     /transl_table="1"
		     /product="envelope glycoprotein, V3 region"
		     /protein_id="AAB07150.1"
		     /db_xref="GI:818243"
		     /translation="GSLAEEEVVIRSENFTNNAKTIIVQLKESVEINCTRPSNNTRRS
		     ITIGPGRAFYTTGAITGDIRQAHCNISRGKWNDTLKQIVKKLGEQFKNKTIVFKQSSG
		     GDPE"
BASE COUNT	142 a	  43 c	   66 g     68 t
ORIGIN
       1 ggcagtctag cggaagaaga ggtagtaatt aggtctgaaa atttcacgaa taatgctaaa 
      61 accataatag tacagctgaa agaatctgta gaaattaatt gtacaagacc cagcaataat 
     121 acaagaagaa gtataactat aggaccaggg agagcatttt atacaacagg agctataaca 
     181 ggagatataa gacaagcaca ttgtaacatt agtagaggaa aatggaatga cactttaaaa 
     241 cagatagtta aaaaattagg agaacaattt aagaataaaa caatagtctt taagcaatcc 
     301 tcaggagggg acccagaaa
//
last modified: Tue May 31 10:56 2022


Questions or comments? Contact us at seq-info@lanl.gov.