View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS HIV1U24724 319 bp DNA linear VRL 03-SEP-1996
DEFINITION Human immunodeficiency virus type 1 envelope glycoprotein (env)
gene, V3 region, clone Mbu1.22, partial cds
ACCESSION U24724
VERSION U24724.1 GI:818242
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 319)
Show all sequences for reference 1
AUTHORS Briant,L., Wade,C.M., Puel,J., Brown,A.J. and Guyader,M.
TITLE Analysis of envelope sequence variants suggests multiple mechanisms
of mother-to-child transmission of human immunodeficiency virus
type 1
JOURNAL J. Virol. 69 (6), 3778-3788 (1995)
PUBMED 7745725
REFERENCE 2 (bases 1 to 319)
Show all sequences for reference 2
AUTHORS Briant,L., Wade,C.M., Puel,J., Leigh Brown,A.J. and Guyader,M.
TITLE Direct Submission
JOURNAL Submitted (04-APR-1995) Chris M. Wade, Centre for HIV Research,
ICAPB, Division of Biological Sciences, University of Edinburgh,
King''s Buildings, West Mains Road, Edinburgh, EH9 3JN, Scotland,
United Kingdom
COMMENT B_FR1.ID These 4 sequences are from Toulouse, France. In this
study, 4 mother-infant pairs were followed during pregnancy and
after birth. The inter- and intra-patient sequence similarities of
this set of 308 sequences has been controversial, because some
infant sequences were identical to sequences from other mothers.
For purposes of this V3 section, only one sequence from each of the
4 infants is presented here. (Briant95), (Korber95) and (Learn96).
GenBank entries for all 308 sequences are found with accession
numbers U24717-U24999 and U25001-U25025
FEATURES Location/Qualifiers
source 1..319
/organism="Human immunodeficiency virus 1"
/proviral="Human immunodeficiency virus 1"
/mol_type="genomic DNA"
/isolate="Mother A: 3.5 months pregnancy"
/db_xref="taxon:11676"
/clone="Mbu1.22"
gene 1..319
/gene="env"
CDS <1..>319
/gene="env"
/codon_start="1"
/transl_table="1"
/product="envelope glycoprotein, V3 region"
/protein_id="AAB07150.1"
/db_xref="GI:818243"
/translation="GSLAEEEVVIRSENFTNNAKTIIVQLKESVEINCTRPSNNTRRS
ITIGPGRAFYTTGAITGDIRQAHCNISRGKWNDTLKQIVKKLGEQFKNKTIVFKQSSG
GDPE"
BASE COUNT 142 a 43 c 66 g 68 t
ORIGIN
1 ggcagtctag cggaagaaga ggtagtaatt aggtctgaaa atttcacgaa taatgctaaa
61 accataatag tacagctgaa agaatctgta gaaattaatt gtacaagacc cagcaataat
121 acaagaagaa gtataactat aggaccaggg agagcatttt atacaacagg agctataaca
181 ggagatataa gacaagcaca ttgtaacatt agtagaggaa aatggaatga cactttaaaa
241 cagatagtta aaaaattagg agaacaattt aagaataaaa caatagtctt taagcaatcc
301 tcaggagggg acccagaaa
//
last modified: Tue May 31 10:56 2022