View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS HIV1U13325 105 bp RNA linear VRL 16-APR-1996
DEFINITION Human immunodeficiency virus type 1 patient C127, clone F3,
envelope glycoprotein (env) gene, V3 region, partial cds
ACCESSION U13325
VERSION U13325.1 GI:644683
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 105)
Show all sequences for reference 1
AUTHORS van't Wout,A.B., Kootstra,N.A., Mulder-Kampinga,G.A., Albrecht-van
Lent,N., Scherpbier,H.J., Veenstra,J., Boer,K., Coutinho,R.A.,
Miedema,F. and Schuitemaker,H.
TITLE Macrophage-tropic variants initiate human immunodeficiency virus
type 1 infection after sexual, parenteral, and vertical
transmission
JOURNAL J. Clin. Invest. 94 (5), 2060-2067 (1994)
PUBMED 7962552
REFERENCE 2 (bases 1 to 105)
Show all sequences for reference 2
AUTHORS Bryant,B.W.
TITLE Direct Submission
JOURNAL Submitted (11-AUG-1994) Bart W. Bryant, Los Alamos National
Laboratory, HIV Sequence Database, T-10, Mail Stop K710, Los
Alamos, NM 87545, USA
COMMENT Non syncytia inducing.
FEATURES Location/Qualifiers
source 1..105
/organism="Human immunodeficiency virus 1"
/mol_type="genomic RNA"
/isolate="patient C127"
/db_xref="taxon:11676"
/clone="F3"
gene 1..105
/gene="env"
CDS <1..>105
/gene="env"
/note="V3 region"
/codon_start="1"
/transl_table="1"
/product="envelope glycoprotein"
/protein_id="AAA96895.1"
/db_xref="GI:644684"
/translation="CIRPNNNTRKSITFGPGQAFYATSNIIGDIRQAHC"
BASE COUNT 47 a 20 c 18 g 20 t
ORIGIN
1 tgtattagac ccaacaacaa tacaagaaaa agtataacat tcggaccagg acaagcgttc
61 tatgcaacaa gtaacataat aggagacata agacaagcac attgt
//
last modified: Tue May 31 10:56 2022