View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS HIVFLQ74 327 bp RNA linear VRL 09-JUL-1992
DEFINITION Human immunodeficiency virus type 1, viral sample LC03.DA04, V3
region
ACCESSION M90925
VERSION M90925.1 GI:327309
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 327)
Show all sequences for reference 1
AUTHORS Ou,C.-Y., Ciesielski,C.A., Myers,G., Bandea,C.I., Luo,C.C.,
Korber,B.T.M., Mullins,J.I., Schochetman,G., Berkelman,R.L.,
Economou,A.N., Witte,J.J., Furman,L.J., Satten,G.A., MacInnes,K.A.,
Curran,J.W. and Jaffe,H.W.
TITLE Molecular epidemiology of HIV transmission in a dental practice
JOURNAL Science 256 (5060), 1165-1171 (1992)
PUBMED 1589796
COMMENT Kindly submitted in computer readable form by the CDC (Centers for
Disease Control), Atlanta, GA. The sequence in this entry is one of
6 clone sequences over the V3 region obtained by the CDC from this
Florida control sample. Please note that for this set of sequences,
clone numbers from the V3 region do not correspond with similar
numbers from the V4C3V5 region. There are 236 sequences in this
sample group; all are env V3 sequences or env V4C3V5. They include:
dentist(13), dentist's patients pA(28), pB(34), pC(8), pD(14),
pE(11), pF(13), pG(9), pH(6) and local controls (LC), LC01(28),
LC02(11), LC03(19), LC04(6) and other LC up to LC42 (1-2 sequences
per person).
FEATURES Location/Qualifiers
source 1..327
/organism="Human immunodeficiency virus 1"
/mol_type="genomic RNA"
/db_xref="taxon:11676"
CDS <1..>327
/note="env polyprotein"
/codon_start="1"
/transl_table="1"
/protein_id="AAA44608.1"
/db_xref="GI:327310"
/translation="LAEKEVIIRSENFTDNTKTIIVQLNTSVTINCTRPGNNTRKSIT
MGPGKVFYAGEIIGDIRQAHCNLSRAAWNDTLKQIVGKLQEQFGNKTIIFNHSSGGDP
EIVMHSF"
BASE COUNT 140 a 48 c 62 g 77 t
ORIGIN
1 ctagcagaaa aagaggtaat aattagatct gaaaatttca cggacaatac taaaaccata
61 atagtacagc tgaatacatc tgtaacaatt aattgtacaa gacctggcaa caatacaaga
121 aaaagtataa ctatgggacc ggggaaagta ttttatgcag gagaaataat aggagatata
181 agacaagcac attgtaacct tagtagagca gcatggaatg acactttaaa acagatagtt
241 ggaaaattac aagaacaatt tgggaataaa acaataatct ttaatcactc ctcaggaggg
301 gacccagaaa ttgtaatgca cagtttt
//
last modified: Tue May 31 10:56 2022