View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS HIV140931X 249 bp DNA linear VRL 26-JUL-1993
DEFINITION Human immunodeficiency virus type 1 (4093-1) proviral envelope
glycoprotein (env) gene, V3 region
ACCESSION L11517
VERSION L11517.1 GI:305559
KEYWORDS PCR primer; env gene; envelope glycoprotein; variable region.
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 249)
Show all sequences for reference 1
AUTHORS Murphy,E., Korber,B.T., Georges-Courbot,M.-C., You,B., Pinter,A.,
Cook,D., Kieny,M.-P., Georges,A., Mathiot,C., Barre-Sinoussi,F. and
Girard,M.
TITLE Diversity of V3 region sequences of human immunodeficiency viruses
type 1 from the central African Republic
JOURNAL AIDS Res. Hum. Retroviruses 9 (10), 997-1006 (1993)
PUBMED 8280481
COMMENT Only amino acid sequence reported. L11517, L11472, L11473 and
U43138 are all from the same patient. The 4020 blood sample was
drawn one year before the 4093 sample.
FEATURES Location/Qualifiers
source 1..249
/organism="Human immunodeficiency virus 1"
/proviral="Human immunodeficiency virus 1"
/mol_type="unassigned DNA"
/db_xref="taxon:11676"
gene 1..249
/gene="env"
CDS <1..>249
/gene="env"
/note="V3 region"
/codon_start="1"
/transl_table="1"
/product="envelope glycoprotein"
/protein_id="AAC37844.1"
/db_xref="GI:305560"
/translation="EIIVRSENLTDNDKTIIVQLNTTVNISCTRPNNNKRQGTPIGLG
QALYTTRVIGDIRKAHCNINRKEWNNTLQKVAEKLRELF"
BASE COUNT 114 a 36 c 43 g 56 t
ORIGIN
1 gagataatag ttagatctga aaacctcaca gacaatgata aaaccataat agtacagctt
61 aatacaactg taaacattag ttgtacaagg cccaacaaca ataaaagaca aggtacacct
121 ataggactag ggcaagcact ctatacaaca agagtaatag gggatataag aaaagcacat
181 tgtaatatta atagaaaaga atggaataat actttacaaa aggtagctga gaaattaaga
241 gaacttttt
//
last modified: Tue May 31 10:56 2022