View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS HIV140237X 228 bp DNA linear VRL 26-JUL-1993
DEFINITION Human immunodeficiency virus type 1 (4023-7) proviral envelope
glycoprotein (env) gene, V3 region
ACCESSION L11475
VERSION L11475.1 GI:305484
KEYWORDS PCR primer; env gene; envelope glycoprotein; variable region.
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 228)
Show all sequences for reference 1
AUTHORS Murphy,E., Korber,B.T., Georges-Courbot,M.-C., You,B., Pinter,A.,
Cook,D., Kieny,M.-P., Georges,A., Mathiot,C., Barre-Sinoussi,F. and
Girard,M.
TITLE Diversity of V3 region sequences of human immunodeficiency viruses
type 1 from the central African Republic
JOURNAL AIDS Res. Hum. Retroviruses 9 (10), 997-1006 (1993)
PUBMED 8280481
COMMENT Only amino acid sequence reported. V3-ID: A_CF1.ID These thirteen
sequences are from a set of sequences obtained from 27 symptomatic
patients from the Central AfricanRepublic, from whom blood was
drawn in 1990--1991. The sequences are consensus sequences from
cloned PCR products. DNA was isolated from co-cultured PBMCs.
(Murphy93). GenBank accession numbers L11457--L11458,
L11461--L11463, L11469--L11471, L11474--L11475, L11477--L11479,
L11484--L11496, L11498, L11518 and L11523--L11524. Some of them
were sequenced again by Schmitt et al. unpublished: U43275,
CF1.4023; U43109, CF1.4054; U43139, CF1.11423; U43136, CF1.1286.
FEATURES Location/Qualifiers
source 1..228
/organism="Human immunodeficiency virus 1"
/proviral="Human immunodeficiency virus 1"
/mol_type="unassigned DNA"
/db_xref="taxon:11676"
gene 1..228
/gene="env"
CDS <1..>228
/gene="env"
/note="V3 region"
/codon_start="1"
/transl_table="1"
/product="envelope glycoprotein"
/protein_id="AAC37810.1"
/db_xref="GI:305485"
/translation="TNNAKTIIVQLDSPVIINCTRPNNNTRRSMRIGPGQTFYATGDI
IGDIRQAYCNVSKEGWNTTLQKVATELRTIFS"
BASE COUNT 96 a 38 c 41 g 53 t
ORIGIN
1 acaaacaatg ctaaaaccat aatagtacaa cttgacagtc ctgtaataat taattgtacc
61 agacctaaca acaatacaag aagaagtatg cgtataggac caggacaaac tttctatgca
121 acaggtgata taatagggga tataagacaa gcatattgca atgtcagtaa agaaggatgg
181 aataccactt tgcaaaaggt agctacagaa ttaagaacta tctttagc
//
last modified: Tue May 31 10:56 2022