View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS HIV1S9A 343 bp RNA linear VRL 24-SEP-1993
DEFINITION Human immunodeficiency virus type 1 (S9) structural capsid protein
(gag) gene, partial cds
ACCESSION L02301
VERSION L02301.1 GI:403123
KEYWORDS gag gene; structural capsid protein.
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 343)
Show all sequences for reference 1
AUTHORS Holmes,E.C., Zhang,L.Q., Simmonds,P., Rogers,A.S. and Brown,A.J.
TITLE Molecular investigation of human immunodeficiency virus (HIV)
infection in a patient of an HIV-infected surgeon
JOURNAL J. Infect. Dis. 167 (6), 1411-1414 (1993)
PUBMED 8501332
FEATURES Location/Qualifiers
source 1..343
/organism="Human immunodeficiency virus 1"
/mol_type="genomic RNA"
/isolate="USA (surgeon)"
/db_xref="taxon:11676"
gene 1..343
/gene="gag"
CDS <1..>343
/gene="gag"
/standard_name="p17-24"
/codon_start="3"
/transl_table="1"
/product="structural capsid protein"
/protein_id="AAA43910.1"
/db_xref="GI:554720"
/translation="ELERFAVNPGLLETSGGCRQILEQLQPSLQTGSEELRSLYNTVA
TLYCVHQRIEIKDTKEALDKIEEEQNKSKKKAQQAAADTGNSSQVSQNYPIVQNLQGQ
MVHQAISPRTL"
BASE COUNT 134 a 74 c 78 g 57 t
ORIGIN
1 gggagctaga acgattcgca gtcaatcctg gcctgttaga aacatcagga ggctgtagac
61 aaatactgga acagctacag ccgagccttc agacaggatc agaagaactt agatcattat
121 ataatacagt agcaaccctc tattgtgtgc atcaaaggat agagataaaa gacaccaagg
181 aagccttaga caagatagag gaagagcaaa acaaaagtaa gaaaaaggca cagcaagcag
241 cagctgacac aggaaacagc agccaggtca gccaaaatta ccctatagtg cagaacctcc
301 aggggcaaat ggtacatcag gccatatcac ctagaacttt aaa
//
last modified: Tue May 31 10:56 2022