View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS KC791265 1078 bp RNA linear VRL 12-JUN-2013
DEFINITION HIV-1 isolate R74045 from Thailand pol protein (pol) gene, partial
cds
ACCESSION KC791265
VERSION KC791265.1 GI:510948679
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 1078)
Show all sequences for reference 1
AUTHORS Kiertiburanakul,S., Chaiwarith,R., Sirivichayakul,S., Ditangco,R.,
Jiamsakul,A., Li,P.C.K., Kantipong,P., Lee,C., Ratanasuwan,W.,
Kamarulzaman,A., Sohn,A.H. and Sungkanuparph,S.
TITLE Comparisons of Primary HIV-1 Drug Resistance between Recent and
Chronic HIV-1 Infection within a Sub-Regional Cohort of Asian
Patients.
JOURNAL PLoS. One.. 8(6); e62057 (2013)
PUBMED 23826076
REFERENCE 2 (bases 1 to 1078)
Show all sequences for reference 2
AUTHORS Kiertiburanakul,S., Chaiwarith,R., Sirivichayakul,S., Ditangco,R.,
Jiamsakul,A., Li,P.C.K., Kantipong,P., Lee,C., Ratanasuwan,W.,
Kamarulzaman,A., Sohn,A.H. and Sungkanuparph,S.
TITLE Direct Submission
JOURNAL Submitted (19-MAR-2013) Faculty of Medicine, Ramathibodi Hospital,
Mahidol University, 270 Rama 6 Road, Bangkok 10400, Thailand
COMMENT ##Assembly-Data-START## Sequencing Technology Sanger dideoxy
sequencing ##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..1078
/organism="Human immunodeficiency virus 1"
/mol_type="genomic RNA"
/isolate="R74045"
/host="Homo sapiens"
/db_xref="taxon:11676"
/country="Thailand"
/collection_date="05-Feb-2009"
gene <1..>1078
/gene="pol"
CDS <1..>1078
/gene="pol"
/note="contains protease and reverse transcriptase"
/codon_start="1"
/transl_table="1"
/product="pol protein"
/protein_id="AGN54117.1"
/db_xref="GI:510948680"
/translation="PQITLWQRPLVTVKIGGQLKEALLDTGADDTVLEDINLPGKWKP
KMIGGIGGFIKVRQYDQILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNFPIS
PIDTVPVTLKPGMDGPKVKQWPLTEEKIKALTEICKEMEEEGKISKIGPENPYNTPVF
AIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVP
LDESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRIKNPE
MVIYQYMDDLYVGSDLEIGQHRTKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELH
PDRWTVQPIELPEKDSWTVNDIQKL"
BASE COUNT 418 a 170 c 224 g 256 t 10 other
ORIGIN
1 cctcaaatca ctctttggca acgaccmctt gtcacagtaa aaataggagg gcagctgaaa
61 gaagctctat tagatacagg agcagatgat acagtattag aagatataaa tttgccaggr
121 aartggaaac caaaaatgat agggggaatt ggaggtttta tcaaagtaag gcaatatgat
181 cagatactta tagaaatttg tggaaaaaag gctataggta cagtattagt aggacctaca
241 cctgtcaaca taattggamg aaatatgttg actcagattg gttgtacttt aaatttccca
301 attagtccta ttgacactgt accagtaaca ttaaagccag gaatggatgg accaaaggtt
361 aaacagtggc cattgacaga agaaaaaata aaagcattaa cagaaatttg taaagagatg
421 gaagaggaag gaaaaatttc aaaaattggg cctgaraatc catacaatac tccagtattt
481 gctataaaga aaaargacag taccaaatgg agaaaattag tagatttcag agagctcaat
541 aaaagaactc aggatttttg ggaagttcaa ttaggaatac cgcatccagc aggtttaaaa
601 aagaaaaaat cagtaacagt actagatgtg ggggatgcat atttttcagt tcctttagat
661 gaaagcttta gaaagtatac tgcattcacc atacctagta taaacaatga racaccagga
721 atcagatatc agtacaatgt gctgccacag ggatggaaag gatcaccagc aatattccag
781 agtagcatga caaaaatctt agagcccttt agaataaaaa atccagaaat ggttatytac
841 caatacatgg atgacttgta tgtaggatct gatttagaaa tagggcagca cagaacaaaa
901 atagaggagc taagagctca tctattgagc tggggattta ctacaccaga caaaaarcat
961 cagaaggaac cyccattcct ttggatggga tatgaactcc atcctgatag atggacagtc
1021 cagcctatag aactgccaga aaaagacagc tggactgtca atgatataca gaaattag
//
last modified: Tue May 31 10:56 2022