View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS JX440948 621 bp RNA linear VRL 30-JAN-2013
DEFINITION HIV-1 isolate CP_77 from USA nef protein gene, complete cds
ACCESSION JX440948
VERSION JX440948.1 GI:443900513
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 621)
Show all sequences for reference 1
AUTHORS Mwimanzi,P., Markle,T.J., Martin,E., Ogata,Y., Kuang,X.T.,
Tokunaga,M., Mahiti,M., Pereyra,F., Miura,T., Walker,B.D.,
Brumme,Z.L., Brockman,M.A. and Ueno,T.
TITLE Attenuation of multiple Nef functions in HIV-1 elite controllers
JOURNAL Retrovirology 10 (1), 1 (2013)
PUBMED 23289738
REFERENCE 2 (bases 1 to 621)
Show all sequences for reference 2
AUTHORS Mwimanzi,P.M.
TITLE Direct Submission
JOURNAL Submitted (30-JUL-2012) Faculty of Health Sciences, Simon Fraser
University, 8888 University Drive, Burnaby, BC V5A 1S6, Canada
REFERENCE 3
Show all sequences for reference 3
AUTHORS Toyoda,M., Ogata,Y., Mahiti,M., Maeda,Y., Kuang,X.T., Miura,T.,
Jessen,H., Walker,B.D., Brockman,M.A., Brumme,Z.L. and Ueno,T.
TITLE Differential Ability of Primary HIV-1 Nef Isolates To Downregulate
HIV-1 Entry Receptors.
JOURNAL J. Virol.. 89(18); 9639-52 (2015)
PUBMED 26178998
COMMENT ##Assembly-Data-START## Assembly Method Sequencher v. 9.2
Sequencing Technology Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..621
/organism="Human immunodeficiency virus 1"
/mol_type="genomic RNA"
/isolate="CP_77"
/host="Homo sapiens"
/db_xref="taxon:11676"
/country="USA"
CDS 1..621
/codon_start="1"
/transl_table="1"
/product="nef protein"
/protein_id="AGD79212.1"
/db_xref="GI:443900514"
/translation="MGGKWSKSSVVGWPKIRERMKRAEPAADGVGPASRDLEKHGAIT
SSNTAATNADCAWLEAQEDEDVGFPVRPQVPLRPMTYKAAVDLSHFLKEKGGLEGLVY
SQKRQDILDLWVYHTQGFFPDWQNYTPGPGVRYPLTFGWCFKLVPVDPDKVEEANEGE
DNNLLHPMSLHGMDDPEKEVLIWKFDSTLAFHHRAREKHPEYYKNC"
BASE COUNT 196 a 126 c 171 g 128 t
ORIGIN
1 atgggtggca aatggtcaaa aagtagtgtg gttggatggc ctaagataag agaaagaatg
61 aaacgagctg agccagcagc agatggggta ggaccagcat ctcgggacct ggaaaaacat
121 ggggcaatca caagtagcaa tacagcagct accaatgctg attgtgcctg gctggaagca
181 caagaggacg aggatgtggg ttttccagtc aggcctcagg tacctttaag accaatgact
241 tacaaggcag ctgtagatct tagccatttt ttaaaagaaa aggggggact ggaagggtta
301 gtttactccc agaaaaggca agatatcctt gatctgtggg tctaccacac acagggcttc
361 ttccctgatt ggcagaacta cacaccagga ccaggggtca gatatccact gacctttgga
421 tggtgcttca aactagtacc agttgatcca gataaggtag aagaggccaa tgaaggagag
481 gacaacaatt tgctacaccc tatgagcctg catgggatgg atgacccaga gaaagaagtg
541 ttaatatgga agtttgacag caccctggca tttcatcaca gagcccgaga gaaacatccg
601 gagtactaca agaactgctg a
//
last modified: Tue May 31 10:56 2022