View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS JN371822 324 bp DNA linear VRL 03-AUG-2011
DEFINITION HIV-1 isolate B1E55MID10_c460_10 envelope glycoprotein (env) gene,
partial cds
ACCESSION JN371822
VERSION JN371822.1 GI:342155103
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 324)
Show all sequences for reference 1
AUTHORS Eshleman,S., Hudelson,S., Redd,A., Wang,L., Debes,R., Chen,Y.,
Martens,C., Ricklefs,S., Selig,E., Porcella,S., Piwower-manning,E.,
McCauley,M., Hosseinipour,M., Kumwenda,J., Hakim,J.,
Chariyalertsak,S., Bruyn,G., Grinsztejn,B., Kumarasamy,N.,
Makhema,J., Mayer,K., Pilotto,J., Santos,B., Quinn,T., Cohen,M. and
Hughes,J.
TITLE Direct Submission
JOURNAL Submitted (08-JUL-2011) School of Medicine, Johns Hopkins
University, Wolfe Street, Baltimore, MD 21205, USA
REFERENCE 2
Show all sequences for reference 2
AUTHORS Eshleman,S.H., Hudelson,S.E., Redd,A.D., Wang,L., Debes,R.,
Chen,Y.Q., Martens,C.A., Ricklefs,S.M., Selig,E.J., Porcella,S.F.,
Munshaw,S., Ray,S.C., Piwowar-Manning,E., McCauley,M.,
Hosseinipour,M.C., Kumwenda,J., Hakim,J.G., Chariyalertsak,S., de
Bruyn,G., Grinsztejn,B., Kumarasamy,N., Makhema,J., Mayer,K.H.,
Pilotto,J., Santos,B.R., Quinn,T.C., Cohen,M.S. and Hughes,J.P.
TITLE Analysis of Genetic Linkage of HIV From Couples Enrolled in the HIV
Prevention Trials Network 052 Trial.
JOURNAL J. Infect. Dis.. 204(12); 1918-26 (2011)
PUBMED 21990420
COMMENT Annotation information was provided by the author. Some of the
information does not have GenBank feature identifiers and is being
provided in the comment section. Information in this section is
searchable in HIV Database at Los Alamos (www.hiv.lanl.gov).;
##HIVDataBaseData-START## Sequence Name B1E55MID10_c460_10
Amplification Strategy pyrosequencing Patient Code Couple 052-2104
subject PA ##HIVDataBaseData-END##
FEATURES Location/Qualifiers
source 1..324
/organism="Human immunodeficiency virus 1"
/proviral="Human immunodeficiency virus 1"
/mol_type="genomic DNA"
/isolate="B1E55MID10_c460_10"
/host="Homo sapiens"
/db_xref="taxon:11676"
/note="collected between 2005 and 2011; sequence derived
from 10 multiple pyrosequencing reads subtype: C"
gene <1..>324
/gene="env"
CDS <1..>324
/gene="env"
/codon_start="1"
/transl_table="1"
/product="envelope glycoprotein"
/protein_id="AEL14799.1"
/db_xref="GI:342155104"
/translation="IKQLQARVLAIERYLGDQQLLGIWGCSGKLICTTNVPWNGSWSN
KSYTEIWDNMTWMQWDKEISNYTDTIYRSLEKSQNQQEKNEEELLALDKWKNLWNWFD
ITNWLW"
BASE COUNT 116 a 54 c 81 g 73 t
ORIGIN
1 attaagcagc tccaggcaag agtcctggct atagaaagat acctagggga tcaacagctc
61 ctagggatat ggggctgctc tggaaaactc atctgcacca ctaatgtgcc ttggaacggt
121 agttggagta ataaatctta cacagagatt tgggataaca tgacctggat gcagtgggat
181 aaagaaatta gtaattacac agacacaata tataggtcgc ttgaaaaatc acaaaaccag
241 caggaaaaaa atgaagaaga gttactggca ttggacaagt ggaaaaatct gtggaattgg
301 tttgacataa caaactggct gtgg
//
last modified: Tue May 31 10:56 2022