View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS JN214947 1268 bp RNA linear VRL 07-DEC-2011
DEFINITION HIV-1 isolate 479-7026-6 from USA pol protein (pol) gene, partial
cds
ACCESSION JN214947
VERSION JN214947.1 GI:359302190
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 1268)
Show all sequences for reference 1
AUTHORS Delwart,E., Slikas,E., Stramer,S.L., Kamel,H., Kessler,D.,
Krysztof,D., Tobler,L.H., Carrick,D.M., Steele,W., Todd,D.,
Wright,D.J., Kleinman,S.H. and Busch,M.P.
TITLE Genetic Diversity of Recently Acquired and Prevalent HIV, Hepatitis
B Virus, and Hepatitis C Virus Infections in US Blood Donors.
JOURNAL J. Infect. Dis.. 205(6); 875-885 (2012)
PUBMED 22293432
REFERENCE 2 (bases 1 to 1268)
Show all sequences for reference 2
AUTHORS Slikas,E. and Delwart,E.
TITLE Direct Submission
JOURNAL Submitted (05-JUL-2011) Health Studies, Westat, 1500 Research Blvd,
Rockville, MD 20850, USA
FEATURES Location/Qualifiers
source 1..1268
/organism="Human immunodeficiency virus 1"
/mol_type="genomic RNA"
/isolate="479-7026-6"
/host="Homo sapiens; first time blood donor; age: 41;
race/ethnicity: not available; prevalent HIV infection"
/db_xref="taxon:11676"
/country="USA: West"
/collection_date="2008"
/PCR_primers="fwd_name: maw-26, fwd_seq:
ttggaaatgtggaaaggaaggac, fwd_name: pro-1, fwd_seq:
cagagccaacagccccacca, rev_name: rt21, rev_seq:
ctgtatttctgctattaagtcttttgatggg, rev_name: rt20, rev_seq:
ctgccagttctagctctgcttc"
/note="subtype: B"
gene <1..>1268
/gene="pol"
CDS <1..>1268
/gene="pol"
/note="drug resistant protease mutation: none; drug
resistant RT mutation none; may contain reverse
transcriptase, protease, and polymerase"
/codon_start="3"
/transl_table="1"
/product="pol protein"
/protein_id="AEV22734.1"
/db_xref="GI:359302191"
/translation="GEPQGRDNNSLSEAGADRQGTVPLVFPQITLWQRPLVTIKIGGQ
LKEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYDQIPIEICGHKAVGTVL
VGPTPVNIIGRNLLTQIGCTLNFPISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALV
EICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLG
IPHPAGLKKKKSVTVLDVGDAYFSIPLDENFRKYTAFTIPSTNNEAPGIRYQYNVLPQ
GWKGSPAIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDVEIGEHRAKIEELRQHL
LRWGLTTPDKKHQKEPPFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWA
SQIYAGIKVKQLCKLLRGTKALTEVVQLTE"
BASE COUNT 489 a 221 c 276 g 282 t
ORIGIN
1 gaggagagcc tcagggaaga gacaacaact ccctctcaga agcaggagcc gatagacaag
61 gaactgtacc ccttgtcttc cctcagatca ctctttggca acgacccctt gtcacaataa
121 agataggggg gcaactaaag gaagctctat tagatacagg agcagatgat acagtattag
181 aagaaataaa tttgccagga agatggaaac caaaaatgat agggggaatt ggaggtttta
241 tcaaagtaag acagtatgat cagataccca tagaaatctg tgggcacaaa gctgtaggta
301 cggtattagt aggacctaca cctgtcaaca taattggaag aaatctgttg actcagattg
361 gttgcacttt aaattttccc attagtccta ttgaaaccgt accagtaaaa ttaaagccag
421 gaatggatgg cccaaaagtc aaacaatggc cattaacaga agaaaaaata aaagcattag
481 tagaaatttg tacagaaatg gaaaaggaag ggaaaatttc aaaaataggg cctgaaaatc
541 catacaatac tccagtattt gctataaaga aaaaagacag tactaaatgg agaaaattag
601 tagatttcag agagcttaat aaaagaactc aagacttctg ggaagttcaa ttaggaatac
661 cacatccagc agggttaaaa aagaaaaaat cagtaacagt actggatgtg ggtgatgcgt
721 atttttcaat tcctctagat gaaaacttca ggaagtatac tgcatttacc atacccagta
781 caaacaatga ggcaccaggg attaggtatc agtacaatgt gctcccccaa ggatggaaag
841 ggtcaccagc aatattccaa agtagcatga caaaaatctt agagcctttt agaaaacaaa
901 atccagacat agttatctat caatacatgg atgatttata tgtaggatct gacgtagaaa
961 taggggagca tagagcaaaa atagaggagc tgagacaaca tctgttgagg tgggggttaa
1021 ccacaccaga caaaaaacat cagaaagaac ctccattcct ttggatgggt tatgaactcc
1081 atcctgataa atggacagta cagcctatag tactgccaga aaaagacagc tggactgtca
1141 atgacataca gaagttagtg ggaaaattga attgggcaag ccagatttac gcagggatta
1201 aggtaaagca attatgtaaa ctccttaggg gaaccaaagc actaacagaa gtagtacaac
1261 taacagaa
//
last modified: Tue May 31 10:56 2022