View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS JF906577 1201 bp RNA linear VRL 14-SEP-2011
DEFINITION HIV-1 isolate BJ07149 from China pol protein (pol) and gag protein
(gag) genes, partial cds
ACCESSION JF906577
VERSION JF906577.1 GI:336359852
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 1201)
Show all sequences for reference 1
AUTHORS Ye,J.R., Lu,H.Y., Wang,W.S., Guo,L., Xin,R.L., Yu,S.Q., Wu,T.C.,
Zeng,Y. and He,X.
TITLE The Prevalence of Drug Resistance Mutations Among Treatment-Naive
HIV-Infected Individuals in Beijing, China.
JOURNAL AIDS Res Hum Retroviruses. 2011 Aug 10.
PUBMED 21830915
REFERENCE 2 (bases 1 to 1201)
Show all sequences for reference 2
AUTHORS Ye,J.-R., Lu,H.-Y., Xin,R.-L., Yu,S.-Q., Wang,W.-S., He,X. and
Zeng,Y.
TITLE Direct Submission
JOURNAL Submitted (02-MAY-2011) National Institute for Viral Disease
Control and Prevention, China Center for Disease Prevention and
Control, Yingxin Street Xuan Wu District, Beijng 100052, China
COMMENT Annotation information was provided by the author. Some of the
information does not have GenBank feature identifiers and is being
provided in the comment section. Information in this section is
searchable in HIV Database at Los Alamos (www.hiv.lanl.gov).;
##HIVDataBaseData-START## Sequence Name BJ07149 Sample city Beijing
Culture method primary Sample tissue plasma Patient sex M Patient
age 31 Risk factor NR CD4 count 291 ##HIVDataBaseData-END##
FEATURES Location/Qualifiers
source 1..1201
/organism="Human immunodeficiency virus 1"
/mol_type="genomic RNA"
/isolate="BJ07149"
/host="Homo sapiens"
/db_xref="taxon:11676"
/country="China"
/collection_date="01-Sep-2007"
/note="subtype: CRF01_AE"
gene <1..>1201
/gene="pol"
CDS <1..>1201
/gene="pol"
/codon_start="3"
/transl_table="1"
/product="pol protein"
/protein_id="AEI53675.1"
/db_xref="GI:336359854"
/translation="SFPQITLWQRPLVAVKIGGQLKEALLDTGADDTVLEEINLPGKW
KPKMIGGIGGFIKVRQYDQILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNFP
ISPIDTVPVKLKPGMDGPKVKQWPLTEEKIKALIEICKEMEEEGKISKIGPENPYNTP
VFAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFS
VPLDESFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRTKN
PEIVIYQYMDDLYVGSDLEIGQHRIKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYE
LHPDRWTVQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKIKQLCKLLRGAKALTD
IVPLTEEA"
gene <1..48
/gene="gag"
CDS <1..48
/gene="gag"
/codon_start="1"
/transl_table="1"
/product="gag protein"
/protein_id="AEI53674.1"
/db_xref="GI:336359853"
/translation="SVSLKSLFGNDPLSQ"
BASE COUNT 458 a 196 c 266 g 280 t 1 other
ORIGIN
1 tcagtttccc tcaaatcact ctttggcaac gaccccttgt cgcagtaaaa atagggggac
61 agctgaaaga ggctctatta gatacaggag cagatgatac agtattagaa gaaataaatt
121 tgccaggaaa atggaaacca aaaatgatag ggggaattgg aggctttatm aaggtaagac
181 aatatgatca gatacttata gaaatttgtg gaaaaaaggc tataggtaca gtgttagtag
241 gacctacacc tgtcaacata attgggcgga atatgttgac tcagattggc tgtactttaa
301 attttccaat tagtcctatt gacactgtac cagtaaaact aaagccagga atggatggac
361 caaaagttaa acagtggcca ttgacagagg aaaaaataaa agcattaata gaaatttgta
421 aagagatgga agaggaagga aaaatctcaa aaattgggcc tgaaaatcca tacaatactc
481 cagtatttgc tataaagaaa aaggatggta ccaaatggag gaaattagtg gatttcagag
541 agctcaataa aagaactcag gatttttggg aagttcaatt aggaataccg catccagcag
601 gtttaaaaaa gaaaaaatca gtaacagtac tagacgtggg agatgcatat ttttcagttc
661 ctttagatga aagttttaga aagtatactg cattcaccat acctagtaca aacaatgaga
721 caccaggaat cagatatcag tataatgtgc tgccacaggg atggaaagga tcaccggcaa
781 tattccagag cagcatgaca aaaatcttag agccctttag gacaaaaaat ccagaaatag
841 tcatctatca atacatggat gacttgtatg taggatctga tttagagata gggcagcaca
901 gaataaaaat agaggagcta agagctcatc tattgagctg gggatttact acaccagaca
961 aaaagcatca gaaggaacct ccattccttt ggatgggata tgaactccat cctgacagat
1021 ggacagtcca gcctatagaa ctgccagaaa aagacagctg gactgtcaat gatatacaga
1081 aattagtggg gaaactaaat tgggcgagtc aaatttatgc agggattaag ataaagcaac
1141 tgtgtaaact cctcagggga gctaaagcac taacagacat agtaccactg actgaagaag
1201 c
//
last modified: Tue May 31 10:56 2022