View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS HM363414 627 bp DNA linear VRL 28-SEP-2010
DEFINITION Simian immunodeficiency virus strain SIVreg-REG049-Bioko pol
protein (pol) gene, partial cds
ACCESSION HM363414
VERSION HM363414.1 GI:307377418
KEYWORDS .
SOURCE Simian immunodeficiency virus (SIV)
ORGANISM Simian immunodeficiency virus Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 627)
Show all sequences for reference 1
AUTHORS Worobey,M., Telfer,P., Souquiere,S., Hunter,M., Coleman,C.A.,
Metzger,M.J., Reed,P., Makuwa,M., Hearn,G., Honarvar,S., Roques,P.,
Apetrei,C., Kazanji,M. and Marx,P.A.
TITLE Island biogeography reveals the deep history of SIV
JOURNAL Science 329 (5998), 1487 (2010)
PUBMED 20847261
REFERENCE 2 (bases 1 to 627)
Show all sequences for reference 2
AUTHORS Worobey,M. and Marx,P.A.
TITLE Direct Submission
JOURNAL Submitted (23-MAY-2010) Ecology and Evolutionary Biology,
University of Arizona, 1041 E Lowell, Tucson, AZ 85721, USA
FEATURES Location/Qualifiers
source 1..627
/organism="Simian immunodeficiency virus"
/proviral="Simian immunodeficiency virus"
/mol_type="genomic DNA"
/strain="SIVreg-REG049-Bioko"
/db_xref="taxon:11723"
/country="Equatorial Guinea: Bioko"
/collection_date="12-May-2001"
gene <1..>627
/gene="pol"
CDS <1..>627
/gene="pol"
/codon_start="1"
/transl_table="1"
/product="pol protein"
/protein_id="ADN44044.1"
/db_xref="GI:307377419"
/translation="GIGGNHEVDQLVSKGIRQVLFMEQVELAREDHERYHSNWKFLRD
TYQIPTIVAKEIVNHCPKCQTQGEPKRGQVNTELGLWQMDCTHMEGKVILVAANPASG
YIWAKLIKRETGLETALALLQLAATWPISHIHTDNGPNFTSREFQAAAWWANIEHSTG
IPYNPQSQGVVENMNKLLKKIIGKIREEVEYLETAVAQACFILNFKRKG"
BASE COUNT 236 a 123 c 155 g 113 t
ORIGIN
1 ggtataggag gaaatcatga agtagaccaa ttagtaagca aggggataag acaagtcctc
61 ttcatggaac aagttgagct agccagagaa gatcatgaga gataccacag taattggaaa
121 ttcttaaggg acacatatca gataccaacc atagtggcaa aagagatagt aaatcactgc
181 ccaaaatgcc agacccaagg agagcccaag agaggacaag tgaacacaga attagggctg
241 tggcagatgg actgcaccca catggaaggc aaagtcatct tagtggcggc aaatcccgct
301 agtggataca tatgggctaa gctaataaag agagaaacag gcctggagac ggctttagcc
361 ttgttgcaat tggcagcaac atggcccatc agccacatac atacagataa tggacccaac
421 ttcactagca gggaattcca ggcagcagcc tggtgggcaa acatagaaca tagcacaggg
481 ataccctata acccacaaag ccaaggagta gtagagaaca tgaacaaact cctgaagaaa
541 attattggga aaattagaga ggaagtagaa tacctagaaa cagcagtagc acaagcatgc
601 ttcattttga attttaaaag aaagggg
//
last modified: Tue May 31 10:56 2022