View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS GQ868779 615 bp DNA linear VRL 10-OCT-2009
DEFINITION HIV-1 isolate AZ03101F from USA nef protein (nef) gene, partial cds
ACCESSION GQ868779
VERSION GQ868779.1 GI:260513941
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 615)
Show all sequences for reference 1
AUTHORS Lamers,S.L., Salemi,M., Galligan,D.C., Morris,A., Gray,R.,
Fogel,G., Zhao,L. and McGrath,M.S.
TITLE Human immunodeficiency virus-1 evolutionary patterns associated
with pathogenic processes in the brain.
JOURNAL J. Neurovirol.. 16(3); 230-41 (2010)
PUBMED 20367240
REFERENCE 2 (bases 1 to 615)
Show all sequences for reference 2
AUTHORS Lamers,S.L., Salemi,M., Galligan,D., Morris,A., Gray,R., Fogel,G.,
de Oliveira,T., Zhao,L. and McGrath,M.
TITLE Direct Submission
JOURNAL Submitted (02-SEP-2009) Department of Laboratory Medicine, Positive
Health Program, University of California, San Francisco, San
Francisco, CA 94110, USA
FEATURES Location/Qualifiers
source 1..615
/organism="Human immunodeficiency virus 1"
/proviral="Human immunodeficiency virus 1"
/mol_type="genomic DNA"
/isolate="AZ03101F"
/isolation_source="brain"
/host="Homo sapiens"
/db_xref="taxon:11676"
/country="USA"
/collection_date="2003"
gene <1..>615
/gene="nef"
CDS <1..>615
/gene="nef"
/codon_start="1"
/transl_table="1"
/product="nef protein"
/protein_id="ACX42682.1"
/db_xref="GI:260513942"
/translation="MGGKWSKSSVIGWPAIRERMRRAEPAAEGVGAASRDLEKHGAIT
SSNTAATNADVAWLEAQEDEEVGFPVKPQVPLRPMTYKAAVDLSHFLKEKGGLEGLIY
SQKRQDILDLWVYHTQGYFPDWQNYTQGPGVRFPLTFGWCFKLVPVEPEKIEEANAGE
NNCLLHPMSQHGMDDPEKEVLMWKFDSRLAFHHIAREMHPEYYKN"
BASE COUNT 194 a 128 c 171 g 122 t
ORIGIN
1 atgggtggca agtggtcaaa aagtagtgtg attggatggc ctgctataag ggaaagaatg
61 agacgagctg agccagcagc agaaggggtg ggagcagcat ctcgagacct agaaaaacat
121 ggagcaatca caagtagcaa tacagcagct accaatgctg atgttgcctg gctggaagcc
181 caagaggatg aggaggtggg ttttccagtc aagcctcagg tacccttaag accaatgact
241 tacaaggcag ctgtagatct tagccacttc ttaaaagaaa aggggggact ggaagggtta
301 atttactccc agaaaagaca agatatcctt gatttgtggg tctaccacac acaaggctac
361 ttccctgact ggcagaacta cacacaaggg ccaggggtca gatttccact gacctttgga
421 tggtgcttca agctagtacc agtggagcca gagaaaatag aagaggccaa tgcaggagag
481 aacaactgct tgttacaccc tatgagccaa catgggatgg atgacccaga gaaagaagtg
541 ttaatgtgga agtttgacag ccgcctggca tttcatcaca tagcccgaga gatgcatccg
601 gagtactaca agaac
//
last modified: Tue May 31 10:56 2022