View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS GQ398949 1046 bp DNA linear VRL 29-SEP-2009
DEFINITION HIV-1 isolate 087373569414376 from Italy pol protein (pol) gene,
partial cds
ACCESSION GQ398949
VERSION GQ398949.1 GI:259377870
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 1046)
Show all sequences for reference 1
AUTHORS Vercauteren,J., Wensing,A.M.J., Van de Vijver,D.A.M.C., Albert,J.,
Balotta,C., Hamouda,O., Kucherer,C., Struck,D., Schmit,J.-C.,
Asjo,B., Bruckova,M., Camacho,R.J., Clotet,B., Coughlan,S.,
Grossman,Z., Horban,A., Korn,K., Kostrikis,L., Nielsen,C.,
Paraskevis,D., Poljak,M., Puchhammer-Stockl,E., Riva,C., Ruiz,L.,
Salminen,M., Schuurman,R., Sonnerborg,A., Stanekova,D.,
Stanojevic,M., Vandamme,A.-M. and Boucher,C.A.B.
CONSRTM SPREAD / EuropeHIVResistance
TITLE Transmission of drug-resistant HIV-1 is stabilizing in Europe.
JOURNAL J. Infect. Dis.. 200(10); 1503-8 (2009)
PUBMED 19835478
REFERENCE 2 (bases 1 to 1046)
Show all sequences for reference 2
AUTHORS Vercauteren,J., Wensing,A.M.J., Van de Vijver,D.A.M.C., Albert,J.,
Balotta,C., Hamouda,O., Kuecherer,C., Struck,D., Schmit,J.-C.,
Asjo,B., Bruckova,M., Camacho,R., Clotet,B., Coughlan,S.,
Grossman,Z., Horban,A., Korn,K., Kostrikis,L.G., Nielsen,C.,
Paraskevis,D., Poljak,M., Puchhammer-Stoeckl,E., Riva,C., Ruiz,L.,
Salminen,M., Schuurman,R., Soennerborg,A., Stanekova,D.,
Stanojevic,M., Vandamme,A.-M. and Boucher,C.A.
CONSRTM SPREAD / EuropeHIVResistance
TITLE Direct Submission
JOURNAL Submitted (15-JUL-2009) Rega Institute for Medical Research and
University Hospitals, Katholieke Universiteit Leuven, Leuven,
Belgium
FEATURES Location/Qualifiers
source 1..1046
/organism="Human immunodeficiency virus 1"
/proviral="Human immunodeficiency virus 1"
/mol_type="genomic DNA"
/isolate="reFzcbds70EZvnS"
/host="Homo sapiens"
/db_xref="taxon:11676"
/country="Italy"
/collection_date="2004"
/collected_by="Prof. Dr. C. Balotta"
gene <1..>1046
/gene="pol"
CDS <1..>1046
/gene="pol"
/codon_start="1"
/transl_table="1"
/product="pol protein"
/protein_id="ACW57185.1"
/db_xref="GI:259377871"
/translation="PQITLWQRPLVTVRIGGQPIEALLDTGADDTVLEEINLPGKWKP
KMIGGIGGFIKVRQYDQILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNFPIS
PIETVPVKLKPGMDGPKVKQWPLTEEKIKALKXICTEMEKEXKISKIGPDNPYNTPVF
AIKKKDXTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVP
LDKNFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRTKNPE
IVIYQYMDDLYVGSDLEIGQHRAKIEELREHFLKWGFTTPDKKHQKEPPFLWMGYELH
PDKWTVQPIMLPDK"
misc_feature 31..273
/gene="pol"
/note="Retropepsins, pepsin-like aspartate proteases;
Region: HIV_retropepsin_like; cd05482"
/db_xref="CDD:133149"
misc_feature order(73..75,79..81,85..87,136..144,250..252)
/gene="pol"
/note="inhibitor binding site; inhibition site"
/db_xref="CDD:133149"
misc_feature 73..81
/gene="pol"
/note="catalytic motif; other site"
/db_xref="CDD:133149"
misc_feature 73..75
/gene="pol"
/note="Catalytic residue; other site"
/db_xref="CDD:133149"
misc_feature order(136..150,154..168)
/gene="pol"
/note="Active site flap; active site"
/db_xref="CDD:133149"
misc_feature 349..999
/gene="pol"
/note="RT_like: Reverse transcriptase (RT, RNA-dependent
DNA polymerase)_like family. An RT gene is usually
indicative of a mobile element such as a retrotransposon
or retrovirus. RTs occur in a variety of mobile elements,
including retrotransposons...; Region: RT_like; cl02808"
/db_xref="CDD:141703"
misc_feature 457..999
/gene="pol"
/note="Reverse transcriptase (RNA-dependent DNA
polymerase); Region: RVT_1; pfam00078"
/db_xref="CDD:109146"
misc_feature order(625..642,748..753,844..846,850..855,985..990)
/gene="pol"
/note="active site"
/db_xref="CDD:73150"
misc_feature order(625..642,748..750,850..852)
/gene="pol"
/note="NTP binding site; other site"
/db_xref="CDD:73150"
misc_feature 751..753
/gene="pol"
/note="nucleic acid binding site; other site"
/db_xref="CDD:73150"
misc_feature <1..297
/gene="pol"
/note="protease"
misc_feature 298..>1046
/gene="pol"
/note="reverse transcriptase"
BASE COUNT 416 a 170 c 207 g 247 t 6 other
ORIGIN
1 cctcaaatca ctctttggca gcgaccctta gtcacagtaa gaataggggg acagccaata
61 gaagccctat tagacacagg agcagatgat acagtattag aagaaataaa tttaccagga
121 aaatggaaac caaaaatgat aggaggaatt ggaggtttta tcaaagtaag acaatatgat
181 cagatactca tagaaatttg tggaaaaaag gccataggta cagtattagt aggacctaca
241 cctgtcaaca taattggacg aaatatgttg actcagattg gttgtacttt aaattttcca
301 attagtccta ttgaaaccgt gccagtaaaa ttaaagccag gaatggatgg cccaaaggtt
361 aaacaatggc cattgacaga agaaaaaatw aaagcattaa aagamatttg tacagaratg
421 gaaaaggaag raaaaatttc aaaaattggg cctgacaatc catacaatac tccagtrttt
481 gccataaaga aaaaagatrg tactaaatgg agaaaattag tagatttcag agaactcaat
541 aagagaactc aagacttctg ggaggtccaa ttaggaatac ctcatcccgc aggattaaaa
601 aagaaaaaat cagtaacagt actagatgta ggggatgcat atttttcagt tcccttagat
661 aaaaacttta gaaagtatac tgcattcact atacctagtg taaataatga gacaccagga
721 attagatatc agtacaatgt gcttccacag ggatggaaag gatcaccagc aatatttcag
781 gcaagtatga caaaaatctt agagcccttt agaacaaaaa atccagaaat agtgatctac
841 caatatatgg atgatttata tgtaggatct gacttagaga tagggcagca tagagcaaaa
901 atagaggagt taagagaaca tttcctgaaa tggggattta ccacaccaga caaaaaacat
961 cagaaagaac ctccatttct ttggatggga tatgaactcc atcctgacaa atggacagtc
1021 cagcctataa tgctgccaga taaaga
//
last modified: Tue May 31 10:56 2022