View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS GQ252708 459 bp DNA linear VRL 22-JUL-2009
DEFINITION HIV-1 isolate D03724B6 from Uganda gag protein (gag) gene, partial
cds
ACCESSION GQ252708
VERSION GQ252708.1 GI:254072049
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 459)
Show all sequences for reference 1
AUTHORS Kiwanuka,N., Laeyendecker,O., Quinn,T.C., Wawer,M.J., Shepherd,J.,
Robb,M., Kigozi,G., Kagaayi,J., Serwadda,D., Makumbi,F.E.,
Reynolds,S.J. and Gray,R.H.
TITLE HIV-1 subtypes and differences in heterosexual HIV transmission
among HIV-discordant couples in Rakai, Uganda.
JOURNAL AIDS. 23(18); 2479-84 (2009)
PUBMED 19841572
REFERENCE 2 (bases 1 to 459)
Show all sequences for reference 2
AUTHORS Kiwanuka,N., Layendecker,O., Quinn,T.C., Wawer,M.J., Shepherd,J.,
Robb,M., Kigozi,G., Kagaayi,J., Serwadda,D., Makumbi,F.E.,
Reynolds,S.J. and Gray,R.H.
TITLE Direct Submission
JOURNAL Submitted (09-JUN-2009) School of Public Health, Makerere
University, Kampala, Uganda
REFERENCE 3
Show all sequences for reference 3
AUTHORS Gray,R.R., Tatem,A.J., Lamers,S., Hou,W., Laeyendecker,O.,
Serwadda,D., Sewankambo,N., Gray,R.H., Wawer,M., Quinn,T.C.,
Goodenow,M.M. and Salemi,M.
TITLE Spatial phylodynamics of HIV-1 epidemic emergence in east Africa.
JOURNAL AIDS. 23(14); F9-F17 (2009)
PUBMED 19644346
REFERENCE 4
Show all sequences for reference 4
AUTHORS Collinson-Streng,A.N., Redd,A.D., Sewankambo,N.K., Serwadda,D.,
Rezapour,M., Lamers,S.L., Gray,R.H., Wawer,M.J., Quinn,T.C. and
Laeyendecker,O.
TITLE Geographic HIV type 1 subtype distribution in Rakai district,
Uganda.
JOURNAL AIDS Res. Hum. Retroviruses. 25(10); 1045-8 (2009)
PUBMED 19803713
FEATURES Location/Qualifiers
source 1..459
/organism="Human immunodeficiency virus 1"
/proviral="Human immunodeficiency virus 1"
/mol_type="genomic DNA"
/isolate="D03724B6"
/host="Homo sapiens"
/db_xref="taxon:11676"
/country="Uganda:Kibale-Rakai"
/collection_date="17-Sep-1997"
/note="subtype: D"
gene <1..>459
/gene="gag"
CDS <1..>459
/gene="gag"
/note="p24"
/codon_start="1"
/transl_table="1"
/product="gag protein"
/protein_id="ACT64732.1"
/db_xref="GI:254072050"
/translation="LNAWVKVIEEKAFSPEVIPMFTALSEGATSYDLNTMLNTVGGHQ
AAMQMLKETINEEAAEWDRLHPVQAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTSN
PPIPVGEIYKRWIVLGLNKIVRMYSPVSILDIRQGPKEPFRDYVDRFYKTL"
BASE COUNT 170 a 80 c 108 g 101 t
ORIGIN
1 ttgaacgcat gggtaaaagt aatagaggag aaggctttta gtccagaagt aatacccatg
61 tttacagcat tatcagaagg agccacctct tatgatttaa atactatgct aaacacagtg
121 gggggacatc aagcagccat gcaaatgtta aaagagacca tcaatgagga agctgcagaa
181 tgggataggt tacatccagt gcaggcaggg cctattgcgc caggccaaat gagagaacca
241 aggggaagtg atatagcagg aactactagt acccttcagg aacaaatagg atggatgaca
301 agtaatccac ctatcccagt aggagaaatt tataaaagat ggatagtcct aggattaaat
361 aaaatagtaa gaatgtatag cccagtcagc attttggaca taagacaagg accaaaggaa
421 ccctttagag actatgtaga tcggttctat aaaactcta
//
last modified: Tue May 31 10:56 2022