View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS FJ520314 721 bp DNA linear VRL 24-APR-2009
DEFINITION HIV-1 isolate i11bclone12 from India pol protein (pol) gene,
partial cds
ACCESSION FJ520314
VERSION FJ520314.1 GI:226993412
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 721)
Show all sequences for reference 1
AUTHORS Moorthy,A., Gupta,A., Bhosale,R., Tripathy,S., Sastry,J.,
Kulkarni,S., Thakar,M., Bharadwaj,R., Kagal,A., Bhore,A.V.,
Patil,S., Kulkarni,V., Venkataramani,V., Balasubramaniam,U.,
Suryavanshi,N., Ziemniak,C., Gupte,N., Bollinger,R. and Persaud,D.
TITLE Nevirapine resistance and breast-milk HIV transmission: effects of
single and extended-dose nevirapine prophylaxis in subtype C
HIV-infected infants
JOURNAL PLoS ONE 4 (1), E4096 (2009)
PUBMED 19119321
REFERENCE 2 (bases 1 to 721)
Show all sequences for reference 2
AUTHORS Foley,B.T.
TITLE Direct Submission
JOURNAL Submitted (03-DEC-2008) Los Alamos National Laboratory, Theoretical
Biology and Biophysics (T10), MSK710, Los Alamos, NM 87544, USA
COMMENT Annotation information was provided by the author. Some of the
information does not have GenBank feature identifiers and is being
provided in the comment section. Information in this section is
searchable in HIV Database at Los Alamos (www.hiv.lanl.gov).;
##HIVDataBaseData-START## Sequence Name i11bclone12 Patient code
i11b Sample date 09/2006 Isolate name clone12 Sample Timepoint
52wks Sample city Pune Subtype C DBID 861021608
##HIVDataBaseData-END##
FEATURES Location/Qualifiers
source 1..721
/organism="Human immunodeficiency virus 1"
/proviral="Human immunodeficiency virus 1"
/mol_type="genomic DNA"
/isolate="i11bclone12"
/host="Homo sapiens"
/db_xref="taxon:11676"
/country="India"
/collection_date="Sep-2006"
/note="subtype: C"
gene <1..>721
/gene="pol"
CDS <1..>721
/gene="pol"
/codon_start="3"
/transl_table="1"
/product="pol protein"
/protein_id="ACP00111.1"
/db_xref="GI:226993413"
/translation="PVETVPVKLKPGMDGPKVKQWPLTEEKIKALTAICDEMEKEGKI
TRIGPENPYNTPIFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKS
VTVLDVGDAYFSVPLYEGFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQAS
MTKILEPFRRQNPDIVIYQYMDDLYVGSDLELGQHRAKIEELRGHLLRWGFTTPDKKH
QKEPPFLWMGYELHPDKWTVQP"
BASE COUNT 281 a 121 c 156 g 163 t
ORIGIN
1 gtcctgttga aactgtacca gtaaaattaa agccaggaat ggatggccca aaggttaaac
61 aatggccatt gacagaagaa aaaataaaag cattaacggc aatttgtgat gaaatggaaa
121 aggaaggaaa aattacaaga attgggcctg agaatccata taacactcca atatttgcca
181 taaaaaagaa ggacagtact aaatggagaa aattagtaga tttcagggaa ctcaataaaa
241 gaactcaaga tttttgggaa gttcagttag gaataccgca cccagcaggg ttaaaaaaga
301 aaaaatcagt gacagtactg gatgtggggg atgcatattt ttcagttcca ttatatgaag
361 gcttcaggaa atatactgca tttaccatac ctagtacaaa caatgaaaca ccagggatta
421 ggtatcaata taatgtgctt ccacagggat ggaaaggatc accagcaata tttcaggcta
481 gcatgacaaa aatcctagag ccctttagaa gacaaaatcc agacatagtc atctatcaat
541 atatggatga cttgtatgta ggatcggact tagaactagg gcaacataga gcaaaaatag
601 aggagttaag aggacatctg ttaaggtggg gattcaccac accagacaag aaacatcaga
661 aagaaccccc atttctttgg atggggtatg aactccatcc tgataaatgg acagtacagc
721 c
//
last modified: Tue May 31 10:56 2022