HIV Databases HIV Databases home HIV Databases home
HIV Sequence Database



Download: ENTIRE SEQUENCE SEQUENCE FRAGMENT start end
Format:  
View NCBI entry		Download GenBank file		Graphics View		Download GFF3 File

LOCUS	    FJ520308		     628 bp    DNA     linear	VRL 24-APR-2009
DEFINITION  HIV-1 isolate i11apopulation1 from India pol protein (pol) gene,
	    partial cds
ACCESSION   FJ520308
VERSION     FJ520308.1 GI:226993400
KEYWORDS    .
SOURCE	    Human immunodeficiency virus 1 (HIV-1)
  ORGANISM  Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
	    Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
	    group
REFERENCE   1 (bases 1 to 628)
            Show all sequences for reference 1
  AUTHORS   Moorthy,A., Gupta,A., Bhosale,R., Tripathy,S., Sastry,J.,
	    Kulkarni,S., Thakar,M., Bharadwaj,R., Kagal,A., Bhore,A.V.,
	    Patil,S., Kulkarni,V., Venkataramani,V., Balasubramaniam,U.,
	    Suryavanshi,N., Ziemniak,C., Gupte,N., Bollinger,R. and Persaud,D.
  TITLE     Nevirapine resistance and breast-milk HIV transmission: effects of
	    single and extended-dose nevirapine prophylaxis in subtype C
	    HIV-infected infants
  JOURNAL   PLoS ONE 4 (1), E4096 (2009)
  PUBMED    19119321
REFERENCE   2 (bases 1 to 628)
            Show all sequences for reference 2
  AUTHORS   Foley,B.T.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-DEC-2008) Los Alamos National Laboratory, Theoretical
	    Biology and Biophysics (T10), MSK710, Los Alamos, NM 87544, USA
COMMENT     Annotation information was provided by the author. Some of the
	    information does not have GenBank feature identifiers and is being
	    provided in the comment section. Information in this section is
	    searchable in HIV Database at Los Alamos (www.hiv.lanl.gov).;
	    ##HIVDataBaseData-START## Sequence Name i11apopulation1 Patient
	    code i11a Sample date 10/2005 Isolate name population1 Sample
	    Timepoint 3wks Sample city Pune Subtype C DBID 1944325994
	    ##HIVDataBaseData-END##
FEATURES             Location/Qualifiers
     source	     1..628
		     /organism="Human immunodeficiency virus 1"
		     /proviral="Human immunodeficiency virus 1"
		     /mol_type="genomic DNA"
		     /isolate="i11apopulation1"
		     /host="Homo sapiens"
		     /db_xref="taxon:11676"
		     /country="India"
		     /collection_date="Oct-2005"
		     /note="subtype: C"
     gene	     <1..>628
		     /gene="pol"
     CDS	     <1..>628
		     /gene="pol"
		     /codon_start="2"
		     /transl_table="1"
		     /product="pol protein"
		     /protein_id="ACP00105.1"
		     /db_xref="GI:226993401"
		     /translation="TVPVKLKPGMDGPKVKQWPLTEEKIKALTAICDEMEKEGKITRI
		     GPENPYNTPIFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTV
		     LDVGDAYFSVPLYEGFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQASMTK
		     ILEPFRKQNPDIVIXQYMDDLYVGSDLELGQHRAKIEELRGHLLRWGFT"
BASE COUNT	251 a	  98 c	  134 g    144 t      1 other
ORIGIN
       1 aactgtacca gtaaaattaa agccaggaat ggatggccca aaggttaaac aatggccatt 
      61 gacagaagaa aaaataaaag cattaacagc aatttgtgat gaaatggaaa aggaaggaaa 
     121 aattacaaga attgggcctg agaatccata taacactcca atatttgcca taaaaaagaa 
     181 ggacagtact aaatggagaa aattagtaga tttcagggaa ctcaataaaa gaactcaaga 
     241 tttttgggaa gttcagttag gaataccgca cccagcaggg ttaaaaaaga aaaaatcagt 
     301 gacagtactg gatgtggggg atgcatattt ttcagttcca ttatatgaag gcttcaggaa 
     361 atatactgca tttaccatac ctagtacaaa caatgaaaca ccagggatta ggtatcaata 
     421 taatgtgctt ccacagggat ggaaaggatc accagcaata tttcaggcta gcatgacaaa 
     481 aatcctagag ccctttagaa aacaaaatcc agacatagtc atctrtcaat atatggatga 
     541 cttgtatgta ggatctgact tagaactagg gcaacataga gcaaaaatag aggagttaag 
     601 aggacatctg ttaaggtggg gattcacc
//
last modified: Tue May 31 10:56 2022


Questions or comments? Contact us at seq-info@lanl.gov.