View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS FJ520308 628 bp DNA linear VRL 24-APR-2009
DEFINITION HIV-1 isolate i11apopulation1 from India pol protein (pol) gene,
partial cds
ACCESSION FJ520308
VERSION FJ520308.1 GI:226993400
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 628)
Show all sequences for reference 1
AUTHORS Moorthy,A., Gupta,A., Bhosale,R., Tripathy,S., Sastry,J.,
Kulkarni,S., Thakar,M., Bharadwaj,R., Kagal,A., Bhore,A.V.,
Patil,S., Kulkarni,V., Venkataramani,V., Balasubramaniam,U.,
Suryavanshi,N., Ziemniak,C., Gupte,N., Bollinger,R. and Persaud,D.
TITLE Nevirapine resistance and breast-milk HIV transmission: effects of
single and extended-dose nevirapine prophylaxis in subtype C
HIV-infected infants
JOURNAL PLoS ONE 4 (1), E4096 (2009)
PUBMED 19119321
REFERENCE 2 (bases 1 to 628)
Show all sequences for reference 2
AUTHORS Foley,B.T.
TITLE Direct Submission
JOURNAL Submitted (03-DEC-2008) Los Alamos National Laboratory, Theoretical
Biology and Biophysics (T10), MSK710, Los Alamos, NM 87544, USA
COMMENT Annotation information was provided by the author. Some of the
information does not have GenBank feature identifiers and is being
provided in the comment section. Information in this section is
searchable in HIV Database at Los Alamos (www.hiv.lanl.gov).;
##HIVDataBaseData-START## Sequence Name i11apopulation1 Patient
code i11a Sample date 10/2005 Isolate name population1 Sample
Timepoint 3wks Sample city Pune Subtype C DBID 1944325994
##HIVDataBaseData-END##
FEATURES Location/Qualifiers
source 1..628
/organism="Human immunodeficiency virus 1"
/proviral="Human immunodeficiency virus 1"
/mol_type="genomic DNA"
/isolate="i11apopulation1"
/host="Homo sapiens"
/db_xref="taxon:11676"
/country="India"
/collection_date="Oct-2005"
/note="subtype: C"
gene <1..>628
/gene="pol"
CDS <1..>628
/gene="pol"
/codon_start="2"
/transl_table="1"
/product="pol protein"
/protein_id="ACP00105.1"
/db_xref="GI:226993401"
/translation="TVPVKLKPGMDGPKVKQWPLTEEKIKALTAICDEMEKEGKITRI
GPENPYNTPIFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTV
LDVGDAYFSVPLYEGFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQASMTK
ILEPFRKQNPDIVIXQYMDDLYVGSDLELGQHRAKIEELRGHLLRWGFT"
BASE COUNT 251 a 98 c 134 g 144 t 1 other
ORIGIN
1 aactgtacca gtaaaattaa agccaggaat ggatggccca aaggttaaac aatggccatt
61 gacagaagaa aaaataaaag cattaacagc aatttgtgat gaaatggaaa aggaaggaaa
121 aattacaaga attgggcctg agaatccata taacactcca atatttgcca taaaaaagaa
181 ggacagtact aaatggagaa aattagtaga tttcagggaa ctcaataaaa gaactcaaga
241 tttttgggaa gttcagttag gaataccgca cccagcaggg ttaaaaaaga aaaaatcagt
301 gacagtactg gatgtggggg atgcatattt ttcagttcca ttatatgaag gcttcaggaa
361 atatactgca tttaccatac ctagtacaaa caatgaaaca ccagggatta ggtatcaata
421 taatgtgctt ccacagggat ggaaaggatc accagcaata tttcaggcta gcatgacaaa
481 aatcctagag ccctttagaa aacaaaatcc agacatagtc atctrtcaat atatggatga
541 cttgtatgta ggatctgact tagaactagg gcaacataga gcaaaaatag aggagttaag
601 aggacatctg ttaaggtggg gattcacc
//
last modified: Tue May 31 10:56 2022