View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS FJ430378 621 bp DNA linear VRL 16-DEC-2008
DEFINITION HIV-1 isolate ES8provirus10 from USA nef protein (nef) gene,
complete cds
ACCESSION FJ430378
VERSION FJ430378.1 GI:217323032
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 621)
Show all sequences for reference 1
AUTHORS Bailey,J.R., Brennan,T.P., O'Connell,K.A., Siliciano,R.F. and
Blankson,J.N.
TITLE Evidence of CD8+ T-cell-mediated selective pressure on human
immunodeficiency virus type 1 nef in HLA-B*57+ elite suppressors.
JOURNAL J. Virol.. 83(1); 88-97 (2009)
PUBMED 18945771
REFERENCE 2 (bases 1 to 621)
Show all sequences for reference 2
AUTHORS Blankson,J.N.
TITLE Direct Submission
JOURNAL Submitted (31-OCT-2008) Medicine, Johns Hopkins University School
of Medicine, 733 N Broadway, Baltimore, MD 21205, USA
REFERENCE 3
Show all sequences for reference 3
AUTHORS Salgado,M., Brennan,T.P., O'Conell,K.A., Bailey,J.R., Ray,S.C.,
Siliciano,R.F. and Blankson,J.N.
TITLE Evolution of the HIV-1 nef gene in HLA-B*57 Positive Elite
Suppressors
JOURNAL Retrovirology 7 (1), 94 (2010)
PUBMED 21059238
FEATURES Location/Qualifiers
source 1..621
/organism="Human immunodeficiency virus 1"
/proviral="Human immunodeficiency virus 1"
/mol_type="genomic DNA"
/isolate="ES8provirus10"
/db_xref="taxon:11676"
/country="USA"
/note="collected 2004-2005"
gene 1..621
/gene="nef"
CDS 1..621
/gene="nef"
/codon_start="1"
/transl_table="1"
/product="nef protein"
/protein_id="ACK37926.1"
/db_xref="GI:217323033"
/translation="MGNKWSKSKLGGWFTVRERMRRTEPAADGMGPASRDLERHGALT
SSNTAATNADCAWLEAQEEEEVGFPIRPQVPLRPMTYKSALDLSHFLKEKGGLEGLIY
SQKRQEILDLWVYHTQGFFPDWQNYTPGPGTRYPLTFGWCFKLVPVDPEKVEEANEGE
NNCLLHPMSQHGMDDPEKEVLVWRFDSRLAFHHLARELHPEFYKDC"
BASE COUNT 193 a 132 c 170 g 126 t
ORIGIN
1 atgggtaata agtggtcaaa aagtaagctg gggggatggt tcactgtaag ggaaagaatg
61 agaagaactg aaccagcagc agatgggatg ggaccagcat ctcgggacct agaaagacat
121 ggagcactca caagtagcaa tacagcagct accaatgctg attgtgcctg gctagaagca
181 caagaggagg aggaggtggg ttttccaatc agacctcagg tacctttaag accaatgact
241 tataagtcag ctctggatct tagccacttt ttaaaagaaa aggggggact ggaagggcta
301 atttattccc agaaaagaca agagatcctt gatctgtggg tctaccacac acaaggcttc
361 ttccctgact ggcagaacta cacaccaggg ccagggacca gatatcccct gaccttcgga
421 tggtgcttca agctagtacc agttgatcca gagaaagtag aagaagccaa tgaaggagag
481 aacaactgct tgttacaccc tatgagccag catgggatgg atgacccaga gaaagaagtg
541 ctagtatgga ggtttgacag ccgcctagca tttcatcact tggcccgaga gctgcatccg
601 gagttctaca aggactgctg a
//
last modified: Tue May 31 10:56 2022