View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS EU841436 630 bp DNA linear VRL 15-SEP-2008
DEFINITION HIV-1 isolate 20 from Uganda gag protein (gag) gene, partial cds
ACCESSION EU841436
VERSION EU841436.1 GI:198443983
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 630)
Show all sequences for reference 1
AUTHORS Sacktor,N., Nakasujja,N., Skolasky,R.L., Rezapour,M., Robertson,K.,
Musisi,S., Katabira,E., Ronald,A., Clifford,D.B., Laeyendecker,O.
and Quinn,T.C.
TITLE Direct Submission
JOURNAL Submitted (20-JUN-2008) Department of Neurology, Johns Hopkins
Bayview Medical Center, 4940 Eastern Ave., B Bldg. Rm. 123,
Baltimore, MD 21224, USA
REFERENCE 2
Show all sequences for reference 2
AUTHORS Sacktor,N., Nakasujja,N., Skolasky,R.L., Rezapour,M., Robertson,K.,
Musisi,S., Katabira,E., Ronald,A., Clifford,D.B., Laeyendecker,O.
and Quinn,T.C.
TITLE HIV subtype D is associated with dementia, compared with subtype A,
in immunosuppressed individuals at risk of cognitive impairment in
Kampala, Uganda
JOURNAL Clin. Infect. Dis. 49 (5), 780-786 (2009)
PUBMED 19622045
FEATURES Location/Qualifiers
source 1..630
/organism="Human immunodeficiency virus 1"
/proviral="Human immunodeficiency virus 1"
/mol_type="genomic DNA"
/isolate="20"
/isolation_source="male patient"
/db_xref="taxon:11676"
/country="Uganda: Kampala"
/note="collected between Sep-2005 and Jan-2007; Memorial
Sloan Kettering Dementia Scale (MSK) = 0.5 subtype: A1"
gene <1..>630
/gene="gag"
CDS <1..>630
/gene="gag"
/codon_start="1"
/transl_table="1"
/product="gag protein"
/protein_id="ACH88174.1"
/db_xref="GI:198443984"
/translation="SPEVIPMFSALSEGATPQDLNMMLNIVGGHQAAMQMLKDTINEE
AAEWDRLHPIHAGPIAPGQVREPRGSDIAGTTSTPQEQIAWMTGNPPIPVGDIYKRWI
ILGLNKIVRMYSPVSILDIKQGPKEPFRDYVDRFFKCLRAEQATQEVKGWMTETLLVQ
NANPDCKTILRALGAGATLEEMMTACQGVGGPGHKARVLAEAMSQVQHTN"
BASE COUNT 226 a 122 c 155 g 127 t
ORIGIN
1 agtccagaag taatacccat gttttcagca ttatcagaag gagccacccc acaagattta
61 aatatgatgc tgaacatagt ggggggacat caggcagcta tgcaaatgct aaaagatacc
121 atcaatgagg aagctgcaga gtgggacagg ctacatccaa tccatgcagg gcctattgca
181 ccaggccagg taagagaacc aaggggaagt gatatagcag gaaccaccag tacccctcaa
241 gaacaaatag catggatgac aggcaaccca cctatcccag tgggagacat ctataaaaga
301 tggataatcc tgggattaaa taaaatagta agaatgtata gccctgttag cattttggat
361 ataaaacaag gtcctaaaga acccttcaga gactatgtag acaggttctt taaatgtctt
421 agagctgagc aagctacaca ggaagtaaaa ggttggatga cggaaacatt actggtccaa
481 aatgcaaatc cagattgtaa gaccatttta agagcattag gagcaggggc tacattagaa
541 gaaatgatga cagcatgcca gggagtggga ggacccggcc ataaagcaag ggttttggct
601 gaggcaatga gtcaagtgca acatacaaac
//
last modified: Tue May 31 10:56 2022