HIV Databases HIV Databases home HIV Databases home
HIV Sequence Database



Download: ENTIRE SEQUENCE SEQUENCE FRAGMENT start end
Format:  
View NCBI entry		Download GenBank file		Graphics View		Download GFF3 File

LOCUS	    EU579002		    2785 bp    RNA     linear	VRL 05-JUN-2009
DEFINITION  HIV-1 isolate CH77S_B12 from USA rev protein (rev) and tat protein
	    (tat) genes, partial cds; vpu protein (vpu) gene, complete cds; and
	    env pseudogene, complete sequence
ACCESSION   EU579002
VERSION     EU579002.2 GI:238915324
KEYWORDS    .
SOURCE	    Human immunodeficiency virus 1 (HIV-1)
  ORGANISM  Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
	    Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
	    group
REFERENCE   1 (bases 1 to 2544)
            Show all sequences for reference 1
  AUTHORS   Keele,B.F., Giorgi,E.E., Salazar-Gonzalez,J.F., Decker,J.M.,
	    Pham,K.T., Salazar,M.G., Sun,C., Grayson,T., Wang,S., Li,H.,
	    Wei,X., Jiang,C., Kirchherr,J.L., Gao,F., Anderson,J.A., Ping,L.H.,
	    Swanstrom,R., Tomaras,G.D., Blattner,W.A., Goepfert,P.A.,
	    Kilby,J.M., Saag,M.S., Delwart,E.L., Busch,M.P., Cohen,M.S.,
	    Montefiori,D.C., Haynes,B.F., Gaschen,B., Athreya,G.S., Lee,H.Y.,
	    Wood,N., Seoighe,C., Perelson,A.S., Bhattacharya,T., Korber,B.T.,
	    Hahn,B.H. and Shaw,G.M.
  TITLE     Identification and characterization of transmitted and early
	    founder virus envelopes in primary HIV-1 infection
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 105 (21), 7552-7557 (2008)
  PUBMED    18490657
REFERENCE   2 (bases 1 to 2544)
            Show all sequences for reference 2
  AUTHORS   Keele,B.F. and Salazar-Gonzalez,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (17-MAR-2008) Department of Medicine, Kaul 806,
	    University of Alabama at Birmingham, 720 20th Street South,
	    Birmingham, AL 35294, USA
REFERENCE   3
            Show all sequences for reference 3
  AUTHORS   Salazar-Gonzalez,J.F., Salazar,M.G., Keele,B.F., Learn,G.H.,
	    Giorgi,E.E., Li,H., Decker,J.M., Wang,S., Baalwa,J., Kraus,M.H.,
	    Parrish,N.F., Shaw,K.S., Guffey,M.B., Bar,K.J., Davis,K.L.,
	    Ochsenbauer-Jambor,C., Kappes,J.C., Saag,M.S., Cohen,M.S.,
	    Mulenga,J., Derdeyn,C.A., Allen,S., Hunter,E., Markowitz,M.,
	    Hraber,P., Perelson,A.S., Bhattacharya,T., Haynes,B.F.,
	    Korber,B.T., Hahn,B.H. and Shaw,G.M.
  TITLE     Genetic identity, biological phenotype, and evolutionary pathways
	    of transmitted/founder viruses in acute and early HIV-1 infection.
  JOURNAL   J. Exp. Med.. 206(6); 1273-89 (2009)
  PUBMED    19487424
REFERENCE   4
            Show all sequences for reference 4
  AUTHORS   Gay,C., Dibben,O., Anderson,J.A., Stacey,A., Mayo,A.J.,
	    Norris,P.J., Kuruc,J.D., Salazar-Gonzalez,J.F., Li,H., Keele,B.F.,
	    Hicks,C., Margolis,D., Ferrari,G., Haynes,B., Swanstrom,R.,
	    Shaw,G.M., Hahn,B.H., Eron,J.J., Borrow,P. and Cohen,M.S.
  TITLE     Cross-Sectional Detection of Acute HIV Infection: Timing of
	    Transmission, Inflammation and Antiretroviral Therapy
  JOURNAL   PLoS ONE 6 (5), E19617 (2011)
  PUBMED    21573003
COMMENT     Annotation information was provided by the author. Some of
	    theinformation does not have GenBank feature identifiers and is
	    beingprovided in the comment section. Information in this section
	    issearchable in HIV Database at Los Alamos
	    (www.hiv.lanl.gov).##HIVDataBaseData-START##Patient cohort
	    CHAVI001Fiebig Stage 2Sequence Name CH77S_B12Sample tissue
	    plasmaViral Load 3565728Patient sex MSequence Number 6563Subtype
	    BSample Timepoint SSample date Aug-25-2006Patient code
	    700010077Sample city NorthCarolinaDBID 1081370390Subtype
	    B##HIVDataBaseData-END## This sequence was revised in GenBank;
	    HIVdb update 11/2010.
FEATURES             Location/Qualifiers
     source	     1..2785
		     /organism="Human immunodeficiency virus 1"
		     /mol_type="genomic RNA"
		     /isolate="CH77S_B12"
		     /db_xref="taxon:11676"
		     /country="USA"
		     /note="subtype: B"
     gene	     <1..2643
		     /gene="rev"
     CDS	     join(<1..62,2369..2643)
		     /gene="rev"
		     /codon_start="2"
		     /transl_table="1"
		     /product="rev protein"
		     /protein_id="ACD41546.2"
		     /db_xref="GI:238915326"
		     /translation="GDSDEDLLKTVRLIKRLYQSNPPPSSEGTRQARRNRRRRWRERQ
		     RQIRTLSGWILDDFLGGPAEPVPLHLPPIERLTLDCNEDSGTSGTQGVGNPQILVEPP
		     TVLESGTKE"
     gene	     <1..2459
		     /gene="tat"
     CDS	     join(<1..62,2369..2459)
		     /gene="tat"
		     /codon_start="1"
		     /transl_table="1"
		     /product="tat protein"
		     /protein_id="ACD41545.2"
		     /db_xref="GI:238915325"
		     /translation="RRQRRRPAQDSKINQAPLPKQPTSQLRGDPTGPKESKKKVERET
		     ETDPNT"
     gene	     79..324
		     /gene="vpu"
     CDS	     79..324
		     /gene="vpu"
		     /codon_start="1"
		     /transl_table="1"
		     /product="vpu protein"
		     /protein_id="ACD41547.2"
		     /db_xref="GI:238915327"
		     /translation="MQSLYILGIVALVVAAILAIVVWTIVYIEYRKIVRQRKIDRLLD
		     RIIDRAEDSGNESEGDQEELSALMEMGHHAPWVIDDQ"
     gene	     242..2785
		     /gene="env"
     CDS	     242..2785
		     /gene="env"
		     /pseudo
		     /codon_start="1"
		     /transl_table="1"
BASE COUNT	983 a	 468 c	  650 g    684 t
ORIGIN
       1 cggagacagc gacgaagacc tgctcaagac agtaagatta atcaagcgcc tctaccaaag 
      61 cagtaagtag catctgtaat gcaatcttta tatatattag gaatagtagc attagtagta 
     121 gcagcaatat tagcaatagt tgtgtggacc atagtataca tagaatatag gaaaatagta 
     181 agacaaagga aaatagacag attacttgat agaataatag acagagcaga agacagtggc 
     241 aatgagagcg agggtgatca ggaggaattg tcagcactta tggagatggg gcaccatgct 
     301 ccttgggtta ttgatgatca gtagtgctgc agaacaattg tgggtcacag tttattatgg 
     361 ggtgcctgtg tggaaagaag caaccaccaa tctattttgt gcatcagatg ctaaagtata 
     421 tgatacagag acacataatg tttgggccac ccacgcctgt gtacccacag accccaaccc 
     481 acaagaagta gaattggaaa atgtgacaga aaattttaac atgtggaaaa ataatatggt 
     541 agaacagatg catgaggatg taatcagttt atgggaccaa agcctaaagc catgtgtaaa 
     601 attaaccccg ctctgtgtta ctttaaattg cactgattct aatggtgata gtagcattgc 
     661 taatagtagc agcagtgagg cggtgaaaga aatgaaaaac tgctctttta atattaccac 
     721 aagcataaga gataagttgc aaaaagaata tgcacttttt tataaacttg atgtagtacc 
     781 aatagataca aaaactaata cttctaaata taggttaata agttgtaaca cctcagtcat 
     841 tacacaggcc tgtccaaagg tatcctttga gccaattccc atacattatt gtgccccggc 
     901 tggttttgcg atcctaaaat gtaaagataa aaagttcaat ggaacagggc catgtaaaaa 
     961 ggtcagcaca gtacaatgta cacatggaat taagccagta gtatcaacac agctgctgtt 
    1021 aaatggcagt ctagcagaag aagaggtagt aattagatct gaaaatttca caaacaatgc 
    1081 taaaaccata ctagtacagc tgaacacatc tgtagtaatc aaatgtatga gacccggcaa 
    1141 taatacaagc aaaagtatac atatgggagc attgagagct tttcatgcaa catcaagaat 
    1201 aataggagac acaaggcgag cacattgtaa tgttagtgga gaagattgga ataagacttt 
    1261 aagccatgta gttgacaaat taagagaaca atttaggaat aaaacaatag tctttaacca 
    1321 ttcctcagga ggggatccag aaattgtaat gcacactttt aattgtggag gagaattttt 
    1381 ctactgcgat tcaacagcgc tgtttaatag tacatggagg agaaataaca cttggactgg 
    1441 tactacagga aatatcacac tccaatgcag aataaaacaa attataaaca tgtggcagaa 
    1501 agtaggaaaa gcaatgtatg cccctcccat cagaggatac attaactgtt catcaaatat 
    1561 tacaggactg atattaacaa gagatggtgg taataatgat agtgaaaccg agatcttcag 
    1621 gcctggagga gggaatatga aggacaattg gagaagtgaa ttatataaat ataaagtaat 
    1681 aaaaattgaa ccattaggaa tagcacccac caaggcaaag agaagagtgg tgcaaagaga 
    1741 aaaaagagca ataggaatag gagctcttct ccttgggttc ttaggagcag caggaagcac 
    1801 tatgggcgca gcgtcagtga cgctgacggt acaagccaga caattattgt ctggtatagt 
    1861 gcaacagcag aacaatctgc tgagggctat tgaggcgcaa cagcatctgt tgcaactcac 
    1921 agtctggggc atcaagcagc tccaggcaag aatcctggct gtggaaagat acctacagga 
    1981 tcaacagctc ctagggattt ggggttgctc tggaagagtc atttgcacca ctactgtgcc 
    2041 ttggaatgtt agttggagta ataaatctct gaacgagatt tggaacaaca tgacatggat 
    2101 ggaatgggaa aaagaaatta acaattacac aggtataata tacaccttac ttgaacgatc 
    2161 gcaaagccag caagaaaaga atgaacaaga attattggaa ttggataaat gggcaagttt 
    2221 gtggaattgg tttgacataa caaattggct gtggtacata aaaatattca taatgatagt 
    2281 aggaggctta ataggtttaa gaatagtttt tactgtgctt tctatagtaa atagagttag 
    2341 gcagggatat tcacccttat cgtttcagac ccacctccca gctccgaggg gacccgacag 
    2401 gcccgaagga atcgaagaag aaggtggaga gagagacaga gacagatccg aacacttagt 
    2461 gggtggattc ttgacgattt tctgggtgga cctgcggaac ctgttcctct tcatctacca 
    2521 ccgattgaga gacttactct tgattgcaat gaggattctg gaacttctgg gacgcagggg 
    2581 gtgggaaatc ctcaaatact ggtggaacct cctactgtat tggagtcagg aactaaagaa 
    2641 tagtgctgtt agcttgctca atactatagc catagcagta gctgagggga cagatagggt 
    2701 tatagaagaa ttataaaggg cttggagagc tgttcttaac atacctacaa gaataagaca 
    2761 gggcttagaa agggctttgc tataa
//
last modified: Tue May 31 10:56 2022


Questions or comments? Contact us at seq-info@lanl.gov.