View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS EU125961 762 bp DNA linear VRL 24-SEP-2007
DEFINITION HIV-1 isolate INU161 from Uganda pol protein (pol) gene, partial
cds
ACCESSION EU125961
VERSION EU125961.1 GI:157366522
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 762)
Show all sequences for reference 1
AUTHORS Troyer,R.M., Lalonde,M.S., Fraundorf,E., Demers,K.R., Kyeyune,F.,
Mugyenyi,P., Syed,A., Whalen,C.C., Bajunirwe,F. and Arts,E.J.
TITLE A radiolabeled oligonucleotide ligation assay demonstrates the high
frequency of nevirapine resistance mutations in HIV type 1
quasispecies of NVP-treated and untreated mother-infant pairs from
Uganda.
JOURNAL AIDS Res. Hum. Retroviruses. 24(2); 235-50 (2008)
PUBMED 18284323
REFERENCE 2 (bases 1 to 762)
Show all sequences for reference 2
AUTHORS Troyer,R.M., Lalonde,M.S. and Arts,E.J.
TITLE Direct Submission
JOURNAL Submitted (30-AUG-2007) Department of Medicine, Division of
Infectious Diseases, Case Western Reserve University, 2109 Adelbert
Road, Cleveland, OH 44106, USA
FEATURES Location/Qualifiers
source 1..762
/organism="Human immunodeficiency virus 1"
/proviral="Human immunodeficiency virus 1"
/mol_type="genomic DNA"
/isolate="INU161"
/db_xref="taxon:11676"
/country="Uganda"
gene <1..>762
/gene="pol"
CDS <1..>762
/gene="pol"
/codon_start="1"
/transl_table="1"
/product="pol protein"
/protein_id="ABV45349.1"
/db_xref="GI:157366523"
/translation="TPIFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLK
KKKSVTVLDVGDAYFSVPLDENFRKYTAFTIPSINNETPGTRYQYNVLPQGWKGSPAI
FQSSMTKILEPFRLQNPGIIIYQYMDDLYVGSDLEIGQHRAKVEELRAHLLSWGFTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIQLPDKDSWTVNDIQKLVGKLNWASQIYAGIK
VKQLCKLLRGAKALTDIVTLTEEAELELAENREILK"
BASE COUNT 294 a 131 c 162 g 175 t
ORIGIN
1 actccaatat ttgctataaa gaaaaaagac agcactaaat ggagaaaatt agtagatttt
61 agagagctca ataaaagaac tcaggacttc tgggaagttc aattaggtat accgcatccc
121 gcaggtttaa aaaagaagaa atcagtaacg gtgctggatg tgggggacgc atatttctca
181 gttcctttag atgaaaactt tagaaaatat actgcattca ccatacctag tataaacaat
241 gagacaccag gaaccaggta tcagtacaat gtgcttccac agggatggaa aggatcacca
301 gcaatattcc agagtagcat gacaaaaatc ttagagccct ttagattaca gaatccagga
361 ataattatct atcaatacat ggatgacttg tatgtaggat ctgatttaga aatagggcag
421 catagagcaa aagtagagga gttaagagct catctattga gttggggatt tactacacca
481 gacaagaagc atcagaaaga acccccattt ctttggatgg gatatgaact ccatcctgac
541 aaatggacag tacagccaat acaactgcca gacaaagata gctggactgt caatgatata
601 cagaaactag taggaaaact aaattgggca agtcaaattt atgcaggaat taaagtaaag
661 caactatgta aactcctcag aggagccaaa gcactaacag atatagtaac actgactgag
721 gaagcagaat tagaattggc agagaacagg gagattctaa ag
//
last modified: Tue May 31 10:56 2022