View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS EU125948 762 bp DNA linear VRL 24-SEP-2007
DEFINITION HIV-1 isolate MTU144 from Uganda pol protein (pol) gene, partial
cds
ACCESSION EU125948
VERSION EU125948.1 GI:157366496
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 762)
Show all sequences for reference 1
AUTHORS Troyer,R.M., Lalonde,M.S., Fraundorf,E., Demers,K.R., Kyeyune,F.,
Mugyenyi,P., Syed,A., Whalen,C.C., Bajunirwe,F. and Arts,E.J.
TITLE A radiolabeled oligonucleotide ligation assay demonstrates the high
frequency of nevirapine resistance mutations in HIV type 1
quasispecies of NVP-treated and untreated mother-infant pairs from
Uganda.
JOURNAL AIDS Res. Hum. Retroviruses. 24(2); 235-50 (2008)
PUBMED 18284323
REFERENCE 2 (bases 1 to 762)
Show all sequences for reference 2
AUTHORS Troyer,R.M., Lalonde,M.S. and Arts,E.J.
TITLE Direct Submission
JOURNAL Submitted (30-AUG-2007) Department of Medicine, Division of
Infectious Diseases, Case Western Reserve University, 2109 Adelbert
Road, Cleveland, OH 44106, USA
FEATURES Location/Qualifiers
source 1..762
/organism="Human immunodeficiency virus 1"
/proviral="Human immunodeficiency virus 1"
/mol_type="genomic DNA"
/isolate="MTU144"
/db_xref="taxon:11676"
/country="Uganda"
gene <1..>762
/gene="pol"
CDS <1..>762
/gene="pol"
/codon_start="1"
/transl_table="1"
/product="pol protein"
/protein_id="ABV45336.1"
/db_xref="GI:157366497"
/translation="TPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLK
KKKSVTVLDVGDAYFSVPLDKNFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAI
FQSSMTKILEPFRLKNPEITIYQYMDDLYVGSDLEIGQHRTKVEELRAHLLNWGLTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIQLPSKNSWTVNDIQKLVGKLNWASQIYPGIK
VKQLCKLLRGAKSLTEVVTLTEEAELELAENREILK"
BASE COUNT 299 a 129 c 157 g 177 t
ORIGIN
1 actccagtat ttgctataaa gaaaaaagat agcactaaat ggagaaaatt agtagatttt
61 agagagctca ataaaagaac tcaggacttc tgggaagttc aattaggaat acctcaccct
121 gcaggtttaa aaaagaaaaa atcagtaaca gtactagatg tgggggacgc atatttttca
181 gttcctttag ataaaaactt tagaaagtat actgcgttca ccatacctag tataaacaat
241 gagacaccag gaatcaggta tcagtacaat gtgcttccac agggatggaa aggatcacca
301 gcaatattcc aaagcagcat gacaaaaatc ttagagccct ttagattaaa aaatccagaa
361 ataactatct atcaatacat ggatgacttg tatgtaggat ctgatttaga aatagggcag
421 catagaacaa aagtagaaga gttgagagct catctattga attggggatt gactacccca
481 gacaaaaagc atcagaaaga acctccattc ctatggatgg gatatgaact ccatcctgac
541 aaatggacag tacagcctat acagctgcca agcaaaaata gctggactgt caatgatata
601 cagaaattag tgggaaaact aaattgggca agtcaaattt atccggggat taaagtaaag
661 caactgtgta aactcctcag aggagccaaa tcactaacag aggtagtaac attgactgag
721 gaagcagaat tagaattggc agagaacagg gagattctaa aa
//
last modified: Tue May 31 10:56 2022