View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS EU125938 762 bp DNA linear VRL 24-SEP-2007
DEFINITION HIV-1 isolate INN131 from Uganda pol protein (pol) gene, partial
cds
ACCESSION EU125938
VERSION EU125938.1 GI:157366476
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 762)
Show all sequences for reference 1
AUTHORS Troyer,R.M., Lalonde,M.S., Fraundorf,E., Demers,K.R., Kyeyune,F.,
Mugyenyi,P., Syed,A., Whalen,C.C., Bajunirwe,F. and Arts,E.J.
TITLE A radiolabeled oligonucleotide ligation assay demonstrates the high
frequency of nevirapine resistance mutations in HIV type 1
quasispecies of NVP-treated and untreated mother-infant pairs from
Uganda.
JOURNAL AIDS Res. Hum. Retroviruses. 24(2); 235-50 (2008)
PUBMED 18284323
REFERENCE 2 (bases 1 to 762)
Show all sequences for reference 2
AUTHORS Troyer,R.M., Lalonde,M.S. and Arts,E.J.
TITLE Direct Submission
JOURNAL Submitted (30-AUG-2007) Department of Medicine, Division of
Infectious Diseases, Case Western Reserve University, 2109 Adelbert
Road, Cleveland, OH 44106, USA
FEATURES Location/Qualifiers
source 1..762
/organism="Human immunodeficiency virus 1"
/proviral="Human immunodeficiency virus 1"
/mol_type="genomic DNA"
/isolate="INN131"
/db_xref="taxon:11676"
/country="Uganda"
gene <1..>762
/gene="pol"
CDS <1..>762
/gene="pol"
/codon_start="1"
/transl_table="1"
/product="pol protein"
/protein_id="ABV45326.1"
/db_xref="GI:157366477"
/translation="TPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLK
KKKSVTVLDVGDAYFSVPLDENFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAI
FQSSMAKILEPFRSQNPGIIICQYMDDLYVGSDLEIGQHRIKVEELREHLLRWGFTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIQLPNKDSWTVNDIQKLVGKLNWASQIYAGIK
VKQLCKLLRGAKALTDIVTLTEEAELELAENREILK"
BASE COUNT 297 a 129 c 162 g 174 t
ORIGIN
1 actccagtat ttgctataaa gaaaaaagat agtactaaat ggagaaaatt agtagatttt
61 agagagctca ataaaagaac ccaggacttc tgggaagttc aattaggaat accgcatccc
121 gcaggtttaa aaaagaaaaa atcagtaaca gtactagatg tgggggatgc atatttttca
181 gttcctttag atgaaaactt taggaaatat actgcattca ccatacctag tataaacaat
241 gagacaccag gagtcaggta tcaatacaat gtactcccac aaggatggaa aggatcaccg
301 gcaatattcc agagtagcat ggcaaaaatc ttagagccat ttagatcaca gaatccagga
361 ataattatct gtcagtacat ggatgacttg tatgtaggat ctgatttaga aataggacag
421 catagaataa aagtagagga gttgagagag catctattga ggtggggatt tactacacca
481 gacaaaaagc atcagaaaga acctccattt ctttggatgg gatatgaact ccatcctgac
541 aaatggacag tacagcctat acagctgcca aacaaagaca gctggactgt caatgatata
601 cagaaattag taggaaaact aaattgggcc agccaaattt atgcagggat taaagtaaag
661 caactgtgta aactcctcag aggagccaaa gcactaacag atatagtaac actgactgag
721 gaagcagaac tagaactagc agagaacagg gagattctaa aa
//
last modified: Tue May 31 10:56 2022