View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS EU125875 762 bp DNA linear VRL 24-SEP-2007
DEFINITION HIV-1 isolate MTU035 from Uganda pol protein (pol) gene, partial
cds
ACCESSION EU125875
VERSION EU125875.1 GI:157366350
KEYWORDS .
SOURCE Human immunodeficiency virus 1 (HIV-1)
ORGANISM Human immunodeficiency virus 1 Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 762)
Show all sequences for reference 1
AUTHORS Troyer,R.M., Lalonde,M.S., Fraundorf,E., Demers,K.R., Kyeyune,F.,
Mugyenyi,P., Syed,A., Whalen,C.C., Bajunirwe,F. and Arts,E.J.
TITLE A radiolabeled oligonucleotide ligation assay demonstrates the high
frequency of nevirapine resistance mutations in HIV type 1
quasispecies of NVP-treated and untreated mother-infant pairs from
Uganda.
JOURNAL AIDS Res. Hum. Retroviruses. 24(2); 235-50 (2008)
PUBMED 18284323
REFERENCE 2 (bases 1 to 762)
Show all sequences for reference 2
AUTHORS Troyer,R.M., Lalonde,M.S. and Arts,E.J.
TITLE Direct Submission
JOURNAL Submitted (30-AUG-2007) Department of Medicine, Division of
Infectious Diseases, Case Western Reserve University, 2109 Adelbert
Road, Cleveland, OH 44106, USA
FEATURES Location/Qualifiers
source 1..762
/organism="Human immunodeficiency virus 1"
/proviral="Human immunodeficiency virus 1"
/mol_type="genomic DNA"
/isolate="MTU035"
/db_xref="taxon:11676"
/country="Uganda"
gene <1..>762
/gene="pol"
CDS <1..>762
/gene="pol"
/codon_start="1"
/transl_table="1"
/product="pol protein"
/protein_id="ABV45263.1"
/db_xref="GI:157366351"
/translation="TPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLK
KKKSVTVLDVGDAYFSIPLDESFRKYTAFTIPSRNNETPGIRYQYNVLPQGWKGSPAI
FQSSMTKILEPFRSQNPEIIIYQYMDDLYVGSDLEIGQHRTKIEELRAHLLSWGLTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIKLPEKDSWTVNDIQKLVGKLNWASQIYPGIK
VRQLCKCLRGAKALTEIVPLTAEAELELAENREILK"
BASE COUNT 300 a 129 c 159 g 174 t
ORIGIN
1 actccagtat ttgctataaa gaaaaaagac agcactaagt ggaggaaatt agtagatttc
61 agagagctca ataaaagaac tcaggacttc tgggaagttc aattaggaat accgcatcca
121 gcaggtttaa aaaagaaaaa atcagtaaca gtactagatg tgggggacgc atatttctca
181 attcctttag atgaaagctt tagaaagtat actgccttca ccatacctag tagaaacaat
241 gagacaccag gaatcaggta tcagtacaat gtgcttccac agggatggaa aggatcacca
301 gcaatattcc agagtagcat gacaaaaatc ttagagccct ttagatcaca gaatccagaa
361 ataattatct atcaatacat ggatgacttg tatgtaggat ctgatttaga aatagggcaa
421 catagaacaa aaatagaaga gttgagagct catctgttga gctgggggtt aactacacca
481 gacaaaaagc atcagaaaga acccccattt ctttggatgg gttatgaact ccatcctgat
541 aaatggacag tacagcctat aaaactgcca gaaaaagaca gctggactgt caatgatata
601 caaaaattag taggaaaatt aaattgggca agccagattt atccaggaat taaagtaaga
661 caattatgta aatgtcttag aggagctaaa gcactgacag aaatagtgcc actgacagca
721 gaggcagaat tagaactggc agaaaacagg gaaattctaa aa
//
last modified: Tue May 31 10:56 2022