View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS DQ839796 285 bp RNA linear VRL 23-FEB-2007
DEFINITION Simian immunodeficiency virus isolate c28Q14.4a vpr protein (vpr)
gene, partial cds
ACCESSION DQ839796
VERSION DQ839796.1 GI:110666078
KEYWORDS .
SOURCE Simian immunodeficiency virus
ORGANISM Simian immunodeficiency virus Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 285)
Show all sequences for reference 1
AUTHORS Noel,R.J. Jr.. and Kumar,A.
TITLE SIV Vpr evolution is inversely related to disease progression in a
morphine-dependent rhesus macaque model of AIDS
JOURNAL Virology 359 (2), 397-404 (2007)
PUBMED 17064752
REFERENCE 2 (bases 1 to 285)
Show all sequences for reference 2
AUTHORS Noel,R.J. Jr.. and Kumar,A.
TITLE Direct Submission
JOURNAL Submitted (20-JUN-2006) Department of Biochemistry, Ponce School of
Medicine, 395 Zona Industrial Reparada 2, Ponce, PR 00716-2348,
Puerto Rico
FEATURES Location/Qualifiers
source 1..285
/organism="Simian immunodeficiency virus"
/mol_type="genomic RNA"
/isolate="c28Q14.4a"
/isolation_source="cerebrospinal fluid collected 12 and 20
weeks post infection from 9 different rhesus macaques
infected with SIV17EFr"
/db_xref="taxon:11723"
gene <1..285
/gene="vpr"
CDS <1..285
/gene="vpr"
/codon_start="1"
/transl_table="1"
/product="vpr protein"
/protein_id="ABG81558.1"
/db_xref="GI:110666079"
/translation="NEGPQREPWDEWVVEVLEELKEEALKHFDPRLLTALGNHIYNRH
GDTLEGAGELIRILQRALFMHFRGGCIHSRIGQPGGGNPLSAIPPSRSML"
BASE COUNT 87 a 65 c 70 g 63 t
ORIGIN
1 aatgaaggac cacaaaggga accatgggat gaatgggtag tggaggttct ggaagaactg
61 aaagaagaag ctttaaaaca ttttgatcct cgcttgctaa ctgcacttgg taatcatatc
121 tataatagac atggagacac ccttgaggga gcaggagaac tcattaggat cctccaacga
181 gcgctcttca tgcatttcag aggcggatgc atccactcca gaatcggcca acctggggga
241 ggaaatcctc tctcagctat cccgccctct agaagcatgc tataa
//
last modified: Tue May 31 10:56 2022