View NCBI entry Download GenBank file Graphics View Download GFF3 File
LOCUS DQ346009 627 bp DNA linear VRL 15-AUG-2006
DEFINITION Simian immunodeficiency virus isolate 1/52N.20-7 nef protein (nef)
gene, partial cds
ACCESSION DQ346009
VERSION DQ346009.1 GI:85680527
KEYWORDS .
SOURCE Simian immunodeficiency virus
ORGANISM Simian immunodeficiency virus Viruses; Retro-transcribing viruses;
Retroviridae; Orthoretrovirinae; Lentivirus; Primate lentivirus
group
REFERENCE 1 (bases 1 to 627)
Show all sequences for reference 1
AUTHORS Noel,R.J., Toro-Bahamonde,A., Marrero-Otero,Z., Orsini,S.,
Verma,A.S., Kumar,R. and Kumar,A.
TITLE Lack of correlation between SIV-Nef evolution and rapid disease
progression in morphine-dependent nonhuman primate model of AIDS.
JOURNAL AIDS Res. Hum. Retroviruses 22 (8), 817-23 (2006)
PUBMED 16910840
REFERENCE 2 (bases 1 to 627)
Show all sequences for reference 2
AUTHORS Noel,R.J. Jr.., Toro-Bahamonde,A., Marrero-Otero,Z., Kumar,R.,
Yamamura,Y. and Kumar,A.
TITLE Direct Submission
JOURNAL Submitted (21-DEC-2005) Biochemistry, Ponce School of Medicine, 395
Urb. Industrial Reparada, Zona 2, Ponce, PR 00716, USA
FEATURES Location/Qualifiers
source 1..627
/organism="Simian immunodeficiency virus"
/proviral="Simian immunodeficiency virus"
/mol_type="genomic DNA"
/isolate="1/52N.20-7"
/db_xref="taxon:11723"
gene 1..>627
/gene="nef"
CDS 1..>627
/gene="nef"
/codon_start="1"
/transl_table="1"
/product="nef protein"
/protein_id="ABC72464.1"
/db_xref="GI:85680528"
/translation="MGGAISMRRSRSSGDLRQRLLRARGETYGRLLGEVEDGYSQSPG
GLDKGLGSLSCEGQKYNQGQYMNTPWRNPAEEREKLAYRKQNMDDKDEEDDDLVGVSV
RPKVPLRTMSYKLAIDVSHFIKEKGGPEGIYYSARRHRILDIYLEKEEGIIPDWQDYT
SGPGIRYPKTFGWLWKLVPVNVSDEAQEDEEHYLMHPAQTSQWDDPWGE"
BASE COUNT 210 a 104 c 178 g 135 t
ORIGIN
1 atgggtggag ctatttccat gaggcggtcc aggtcgtctg gagatctgcg acagagactc
61 ttgcgggcgc gtggggagac ttatgggaga ctcttaggag aggtggaaga tggatactcg
121 caatccccag gaggattaga caagggcttg ggctcactct cttgtgaggg acagaaatac
181 aatcagggac agtatatgaa tactccatgg agaaacccag ctgaagagag agaaaaatta
241 gcatacagaa aacaaaatat ggatgataaa gatgaggaag atgatgactt ggtaggggta
301 tcagtgaggc caaaagttcc cctaagaaca atgagttaca aattggcaat agacgtgtct
361 cattttataa aagaaaaggg gggaccggaa gggatttatt acagtgcaag aagacataga
421 atcttagaca tatacttaga aaaggaagaa ggcatcatac cagattggca ggattatacc
481 tcaggaccag gaattagata cccaaagaca tttggctggc tatggaaatt agtccctgta
541 aatgtatcag atgaggcaca ggaggatgag gagcattatt taatgcatcc agctcaaact
601 tcccagtggg atgacccttg gggagag
//
last modified: Tue May 31 10:56 2022